| Sequence 1: | NP_609645.2 | Gene: | CG9302 / 34750 | FlyBaseID: | FBgn0032514 | Length: | 510 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001367560.1 | Gene: | erp-44.1 / 172191 | WormBaseID: | WBGene00016278 | Length: | 411 | Species: | Caenorhabditis elegans |
| Alignment Length: | 195 | Identity: | 59/195 - (30%) |
|---|---|---|---|
| Similarity: | 87/195 - (44%) | Gaps: | 22/195 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 270 NSEIVHLTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPG--LLAALDAT 332
Fly 333 KEPSIAEKYKVKGYPTVKFFSNG-VFKFEV-NVREASKIVEFMRDPKEPPPPPPPEKSWEEEEDS 395
Fly 396 KE----VLFLDDDNFSSTLKRKKHALVMFYAPWC------GHCKHTKPEFTAAATALQDDPRIAF 450
Fly 451 450 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG9302 | NP_609645.2 | PDI_b_PDIR_N | 24..131 | CDD:239365 | |
| PDI_a_PDIR | 144..249 | CDD:239295 | |||
| ER_PDI_fam | 166..500 | CDD:273457 | 59/195 (30%) | ||
| PDI_a_PDIR | 272..373 | CDD:239295 | 40/104 (38%) | ||
| PDI_a_PDIR | 397..498 | CDD:239295 | 14/64 (22%) | ||
| erp-44.1 | NP_001367560.1 | PDI_a_ERp44 | 35..140 | CDD:239294 | 40/105 (38%) |
| PDI_b_ERp44 | 148..245 | CDD:239368 | 16/80 (20%) | ||
| PDI_b'_ERp44 | 256..366 | CDD:239370 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||