DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and ERP27

DIOPT Version :10

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_689534.1 Gene:ERP27 / 121506 HGNCID:26495 Length:273 Species:Homo sapiens


Alignment Length:173 Identity:35/173 - (20%)
Similarity:67/173 - (38%) Gaps:44/173 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ITGQFVFLLLVALVAAKSKTSAVQDDIAEYKDFKKLLR----------TK----------NNVLA 47
            |||..:.|..:    ..::...::|:..|..|..||.|          |:          |:|:.
Human   101 ITGNTICLFRL----VDNEQLNLEDEDIESIDATKLSRFIEINSLHMVTEYNPVTVIGLFNSVIQ 161

  Fly    48 LYVTSAKSAAA-----ELKIFREAAEAIRGTGTMLLLDCGQQDRKKLCK--KLKVSPDP-YAIKH 104
            :::....:.|:     .:..:::||:..:|....:|:|.|.::..|:..  |||.|..| .||..
Human   162 IHLLLIMNKASPEYEENMHRYQKAAKLFQGKILFILVDSGMKENGKVISFFKLKESQLPALAIYQ 226

  Fly   105 YKDGDFHKDYDRQLSVSSMITFM------------RDPSGDLP 135
            ..|.::......::||..:..|.            |:..|..|
Human   227 TLDDEWDTLPTAEVSVEHVQNFCDGFLSGKLLKENRESEGKTP 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365 29/146 (20%)
PDI_a_PDIR 144..249 CDD:239295
PDI_a_PDIR 272..373 CDD:239295
PDI_a_PDIR 397..498 CDD:239295
ERP27NP_689534.1 Thioredoxin_6 64..250 CDD:463999 32/152 (21%)
PDIA3-binding site. /evidence=ECO:0000269|PubMed:16940051 230..233 0/2 (0%)
Prevents secretion from ER. /evidence=ECO:0000305|PubMed:16940051 270..273 35/173 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.