DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and Txndc5

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_663342.3 Gene:Txndc5 / 105245 MGIID:2145316 Length:417 Species:Mus musculus


Alignment Length:372 Identity:108/372 - (29%)
Similarity:188/372 - (50%) Gaps:33/372 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 EEDPAGKDVLHFSDAASFTKHLRKDIRPMLVMFYVPWCGFCKKMKPEYGKASTELKTKGGYILAA 201
            |:||..|   |...|..||..::....  .|||:.||||.|::::|.:.....:..:.....:..
Mouse    43 EQDPHAK---HLYTADMFTHGIQSAAH--FVMFFAPWCGHCQRLQPTWNDLGDKYNSMEDAKVYV 102

  Fly   202 MNVERQENAPIRKMFNITGFPTLIYFENGKLRFTYEGENNKEALVSFMLNP-NAKP-TPKPK-EP 263
            ..|:...::.:.....:.|:|||.:|:.|:....|:|..:.|.|.::||.. |.:| ||:|: ||
Mouse   103 AKVDCTADSDVCSAQGVRGYPTLKFFKPGQEAVKYQGPRDFETLENWMLQTLNEEPATPEPEAEP 167

  Fly   264 EWSADTNSEIVHLTSQGFEPALKDEKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLLAA 328
            ..:.:....:..|::..||..: .:.:..:.|:||||||||.:.|.:|:.||.::..:.. .:..
Mouse   168 PRAPELKQGLYELSANNFELHV-SQGNHFIKFFAPWCGHCKALAPTWEQLALGLEHSETV-KIGK 230

  Fly   329 LDATKEPSIAEKYKVKGYPTVKFFSNGVFKFEVNVREASKIVEFMRD------------PKEPPP 381
            :|.|:..::..:::|:||||:.:|.:|.   :|:..:..:.:|.:||            |:...|
Mouse   231 VDCTQHYAVCSEHQVRGYPTLLWFRDGK---KVDQYKGKRDLESLRDYVQSQLQGSEAAPETVEP 292

  Fly   382 PPPPEKSWEEEEDSKEVLFLDDDNFSSTLKRKKHALVMFYAPWCGHCKHTKPEFTAAA----TAL 442
            ...|..:.|...|...||.|.:.:|..|: .:....|.||||||||||:..|.:...:    ..|
Mouse   293 SEAPVMAAEPTGDKGTVLALTEKSFEDTI-AQGITFVKFYAPWCGHCKNLAPTWEELSKKEFPGL 356

  Fly   443 QDDPRIAFVAIDCTKLAALCAKYNVRGYPTILYFSYLKTKLDYNGGR 489
            .|   :....:|||....:|:||:||||||:|.|...:...::||||
Mouse   357 SD---VTIAEVDCTAERNVCSKYSVRGYPTLLLFRGGEKVGEHNGGR 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295 24/104 (23%)
ER_PDI_fam 166..500 CDD:273457 100/343 (29%)
PDI_a_PDIR 272..373 CDD:239295 27/100 (27%)
PDI_a_PDIR 397..498 CDD:239295 37/97 (38%)
Txndc5NP_663342.3 PDI_a_ERp46 47..150 CDD:239303 25/107 (23%)
ER_PDI_fam 52..417 CDD:273457 103/360 (29%)
PDI_a_ERp46 176..276 CDD:239303 29/104 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 281..302 3/20 (15%)
PDI_a_ERp46 308..409 CDD:239303 37/97 (38%)
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0191
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D522268at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.