DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9302 and XB5909790

DIOPT Version :9

Sequence 1:NP_609645.2 Gene:CG9302 / 34750 FlyBaseID:FBgn0032514 Length:510 Species:Drosophila melanogaster
Sequence 2:NP_001123670.1 Gene:XB5909790 / 100170420 XenbaseID:XB-GENE-5909791 Length:105 Species:Xenopus tropicalis


Alignment Length:99 Identity:28/99 - (28%)
Similarity:47/99 - (47%) Gaps:6/99 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   281 FEPALKD--EKSALVMFYAPWCGHCKRMKPEYEKAALEMKQKKIPGLLAALDATKEPSIAEKYKV 343
            |:..||:  :|..:|.|.|.|||.||.:.|.:||.::|....    :...:|......:|....|
 Frog    11 FQNILKEAGDKLVVVDFTATWCGPCKMISPVFEKLSVENPDV----VFIKVDVDDAQDVAAHCDV 71

  Fly   344 KGYPTVKFFSNGVFKFEVNVREASKIVEFMRDPK 377
            |..||..|:.||....|.:....:.:::.::|.|
 Frog    72 KCMPTFHFYKNGQKVHEFSGANQASLIQKVQDLK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9302NP_609645.2 PDI_b_PDIR_N 24..131 CDD:239365
PDI_a_PDIR 144..249 CDD:239295
ER_PDI_fam 166..500 CDD:273457 28/99 (28%)
PDI_a_PDIR 272..373 CDD:239295 26/93 (28%)
PDI_a_PDIR 397..498 CDD:239295
XB5909790NP_001123670.1 TRX_family 9..100 CDD:239245 26/92 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.