DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6565 and CP5

DIOPT Version :9

Sequence 1:NP_001285891.1 Gene:CG6565 / 34749 FlyBaseID:FBgn0032513 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_176653.1 Gene:CP5 / 842780 AraportID:AT1G64720 Length:385 Species:Arabidopsis thaliana


Alignment Length:284 Identity:72/284 - (25%)
Similarity:116/284 - (40%) Gaps:55/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 PSTSKEAE----TDPDTSISNCLRPLDLDVRNAPAGTVRIQAQDDQKWEPYFSKNEFSIWRRQER 209
            ||.|.:.:    ||.|      .|.|...|.....|...||..|  :..|.||   :..|||...
plant    78 PSLSSKEKTGFVTDDD------FRHLWKLVEVKDGGPCWIQMMD--RSTPTFS---YQAWRRDPE 131

  Fly   210 SSLYSYKVYARFDDITAD---DFLHVQTDLDYRRQWDDTAL---RLELISEDPVPGSNSHLIYWE 268
            :....|:....|:|.|.:   ||.   .|.::|.:|||..|   .||...:     :.:.::.|.
plant   132 NGPPQYRSRTVFEDATPEMVRDFF---WDDEFRSKWDDMLLYSSTLERCKD-----TGTMVVQWV 188

  Fly   269 MQWPRLFANRDYVYCRRYIKDDNKKLIFIC-NRGATHNTYPALSGKVRVTDY---WSLMVIKPFR 329
            .::|...::|:|:..|| |.|..:  :|.| .:|..:.:.|..:...||..|   |.:..::..|
plant   189 RKFPFFCSDREYIIGRR-IWDAGR--VFYCITKGVQYPSVPRQNKPRRVDLYYSSWCIRAVESKR 250

  Fly   330 GFHE-PGLHFVLTYFDDPGIP-------IPQNIKSWVTQKQMPEFLTKMYVATKNYACSRAIKMK 386
            |..| .....:|.:.:|.|||       :.|.:  |...|::...| :.|...|  |....:...
plant   251 GDGEMTSCEVLLFHHEDMGIPWEIAKLGVRQGM--WGAVKKIEPGL-RAYQRAK--AAGAGLSPS 310

  Fly   387 DMFHGFALINDEYTANE---QRGS 407
            .:   .|.||.:.:|.|   :|||
plant   311 AI---MAHINTKVSAEEFMNERGS 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6565NP_001285891.1 START_STARD7-like 170..377 CDD:176920 56/224 (25%)
CP5NP_176653.1 START_STARD2_7-like 89..297 CDD:176879 58/232 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D973910at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19308
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.