DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6565 and AT3G23080

DIOPT Version :9

Sequence 1:NP_001285891.1 Gene:CG6565 / 34749 FlyBaseID:FBgn0032513 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_566722.1 Gene:AT3G23080 / 821882 AraportID:AT3G23080 Length:419 Species:Arabidopsis thaliana


Alignment Length:374 Identity:76/374 - (20%)
Similarity:138/374 - (36%) Gaps:82/374 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 LVGLNIKRMGSDGFDWNKERLALSNFDLCRRDIEFINALPNNQLCDRCQAKKM--------KYCY 134
            ::||.|      |:.|.....:|..... |..:.|:..:|..     ..|:::        .:..
plant    32 MIGLLI------GWSWRPRWTSLVYLGF-RSKLRFLCTVPPG-----FGARRIWLAFTALSAFSV 84

  Fly   135 CQLGNQ-RCKKGQSQP------------STSKEAETDPDTSISNCLRPLDLDVRNAPAGTVRIQA 186
            |...|: ....|.|:|            .|.||.:...:..:.:.|..|:       ||....: 
plant    85 CSTSNKSSVNNGSSKPVEEEAFSRASDKVTEKEKDVVTEKDLEHLLHLLE-------AGNASFE- 141

  Fly   187 QDDQKWEPYFSKN----EFSIWRRQERSSLYSYKVYARFDDITAD---DFLHVQTDLDYRRQWDD 244
                 |:....|:    .:..||.:.......|:....|:|:|.|   ||.   .|.::|.:||.
plant   142 -----WQSMMDKSTPNMSYQAWRHEPEIGPVVYRSRTVFEDVTPDIVRDFF---WDDEFRPKWDT 198

  Fly   245 TALRLELISEDPVPGSNSHLIYWEMQWPRLFANRDYVYCRRYIKDDNKKLIFICNRGATHNTYPA 309
            .....:.:.|||..|:.  :::|..::|...::|:|:..||..:...|  .:...:|.   .|.|
plant   199 MLAYFKTLEEDPKTGTT--IVHWIKKFPFFCSDREYIIGRRIWESGRK--YYAVTKGV---PYKA 256

  Fly   310 LSGK---VRVTDYWSLMVIKPFRGFHEPG----LHFVLTYFDDPGIPIPQNIKS-------WVTQ 360
            ||.:   .||..|:|..:|.........|    ....|.:::|.|  ||:::..       |...
plant   257 LSKRDKPRRVELYFSSWIINAVESRKGDGQMTACEVSLVHYEDMG--IPKDVAKLGVRHGMWGAV 319

  Fly   361 KQMPEFLTKMYVATK-NYACSRAIKMKDMFH--GFALINDEYTANEQRG 406
            |::...|.....|.| ..:.||:.:|..:..  ...|:......:|:||
plant   320 KKLNSGLRAYQSARKPGTSLSRSAQMASITTKLNMDLVETSGAEDEERG 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6565NP_001285891.1 START_STARD7-like 170..377 CDD:176920 50/228 (22%)
AT3G23080NP_566722.1 START_STARD2_7-like 119..329 CDD:176879 49/234 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D973910at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19308
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.880

Return to query results.
Submit another query.