DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6565 and pctp

DIOPT Version :9

Sequence 1:NP_001285891.1 Gene:CG6565 / 34749 FlyBaseID:FBgn0032513 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001124258.1 Gene:pctp / 566726 ZFINID:ZDB-GENE-081022-182 Length:214 Species:Danio rerio


Alignment Length:198 Identity:63/198 - (31%)
Similarity:95/198 - (47%) Gaps:13/198 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 QAQDDQKWEPYFSKNEFSIWR-RQERSSLYSYKVYARFDDITADDFLHVQTDLDYRRQWDDTALR 248
            :.|.|..||.:.......|:| ..:.:.||.|||:......:.:....|..||:||||||...  
Zfish    19 EPQLDGGWEFFTETMNVKIYRLYNKETGLYEYKVFGSLSGCSPELCAEVYMDLNYRRQWDSYV-- 81

  Fly   249 LELISEDPVPGSNSHLIYWEMQWPRLFANRDYVYC--RRYIKDDNKKLIFICNRGATHNTYPALS 311
            .||..:|   .::...||||:::|...:||||||.  ||.:....:|:..:..:..:.:..|...
Zfish    82 KELHEKD---YNDQKAIYWEVKYPMPLSNRDYVYVRERRDLDVSGRKICVVLAKSTSVSQCPEKR 143

  Fly   312 GKVRVTDY-WSLMVIKPFRGFHEPGLHFVLTYFDDPGIPIPQNIKSWVTQKQMPEFLTKMYVATK 375
            |.:||.|| .||.:.....|    |....:.|||:||..||..:.:|..:..:|.|||.|..|..
Zfish   144 GVIRVKDYKQSLAIESDGSG----GTKMFMNYFDNPGGMIPTWLVNWAAKTGVPSFLTDMKKACS 204

  Fly   376 NYA 378
            ||:
Zfish   205 NYS 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6565NP_001285891.1 START_STARD7-like 170..377 CDD:176920 61/195 (31%)
pctpNP_001124258.1 SRPBCC 5..206 CDD:301327 61/195 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430593at33208
OrthoFinder 1 1.000 - - FOG0004152
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.