DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6565 and Stard10

DIOPT Version :9

Sequence 1:NP_001285891.1 Gene:CG6565 / 34749 FlyBaseID:FBgn0032513 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001347389.1 Gene:Stard10 / 56018 MGIID:1860093 Length:364 Species:Mus musculus


Alignment Length:242 Identity:57/242 - (23%)
Similarity:96/242 - (39%) Gaps:43/242 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   147 SQPSTSKEAETDPDTSISNCLRPLDLDVRNAPAGTVRIQAQDDQKWEPYFSKNEFSIWRRQERSS 211
            |:|:..:|:...||          |.|.|     :.|.:.:.:..|...:||...|:|.:.....
Mouse    86 SRPALGRESVQVPD----------DQDFR-----SFRSECEAEVGWNLTYSKAGVSVWVQAVEMD 135

  Fly   212 LYSYKVYARFD--DITADDFLHVQTDLDYRRQWDDTALRLELISEDPVPGSNSHLIYWEMQWPRL 274
            ...:|:..|.:  |:.|:....|..|::||::||...:....|:...|   |:.:.|:..:.|:.
Mouse   136 RTLHKIKCRMECCDVPAETLYDVLHDIEYRKKWDSNVIETFDIARLTV---NADVGYYSWRCPKP 197

  Fly   275 FANRDYVYCRRYIKDDNKKLIFICNRGATHNTYPALSGKVRVTDYWSLMVIK---PFRGFHEPGL 336
            ..|||.:..|.::......:|.  |....|..||.....||.....:..:|:   |        .
Mouse   198 LKNRDVITLRSWLPMGADYIIM--NYSVKHPKYPPRKDLVRAVSIQTGYLIQSTGP--------K 252

  Fly   337 HFVLTYFD--DPGIPIPQNIKSWVTQKQ----MPEFLTKMYVATKNY 377
            ..|:||..  ||...:|:    ||..|.    .|:.:.|||.|...|
Mouse   253 SCVITYLAQVDPKGSLPK----WVVNKSSQFLAPKAMKKMYKACIKY 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6565NP_001285891.1 START_STARD7-like 170..377 CDD:176920 51/217 (24%)
Stard10NP_001347389.1 START_STARD10-like 92..314 CDD:176880 55/236 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5863
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.