DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6565 and Pctp

DIOPT Version :9

Sequence 1:NP_001285891.1 Gene:CG6565 / 34749 FlyBaseID:FBgn0032513 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_058921.1 Gene:Pctp / 29510 RGDID:3276 Length:214 Species:Rattus norvegicus


Alignment Length:189 Identity:57/189 - (30%)
Similarity:91/189 - (48%) Gaps:11/189 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 WEPYFSKNEFSIWRRQERSS-LYSYKVYARFDDITADDFLHVQTDLDYRRQWDDTALRLELISED 255
            |:.....:..:|:|..::|: ||.|||:...:.........|..|||||::||.....|...|.|
  Rat    30 WQLLVEASGITIYRLLDQSTGLYEYKVFGVLESCIPSLLADVYMDLDYRKKWDQYVKELYEKSFD 94

  Fly   256 PVPGSNSHLIYWEMQWPRLFANRDYVYC--RRYIKDDNKKLIFICNRGATHNTYPALSGKVRVTD 318
                 ...:.|||:::|...:||||||.  ||.:..|.:|:..:..:..:...:|..||.:||..
  Rat    95 -----GQMVAYWEVKYPFPLSNRDYVYTRQRRDLDVDGRKIYVVLAQNISVPQFPEKSGVIRVKQ 154

  Fly   319 YWSLMVIKPFRGFHEPGLHFVLTYFDDPGIPIPQNIKSWVTQKQMPEFLTKMYVATKNY 377
            |...:.|:   ...:.|....:.|||:||..||..:.:|..:..:|.||..|..|.:||
  Rat   155 YKQSLAIE---SDGKKGSRVFMYYFDNPGGQIPSWLINWAAKNGVPSFLKDMVKACQNY 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6565NP_001285891.1 START_STARD7-like 170..377 CDD:176920 55/187 (29%)
PctpNP_058921.1 START_STARD2-like 4..210 CDD:176919 55/187 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430593at33208
OrthoFinder 1 1.000 - - FOG0004152
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.