DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6565 and T28D6.7

DIOPT Version :9

Sequence 1:NP_001285891.1 Gene:CG6565 / 34749 FlyBaseID:FBgn0032513 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001366874.1 Gene:T28D6.7 / 189042 WormBaseID:WBGene00012127 Length:268 Species:Caenorhabditis elegans


Alignment Length:201 Identity:53/201 - (26%)
Similarity:89/201 - (44%) Gaps:18/201 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 VRIQAQDDQKWEPYFSKNEFSIWRRQ-ERSSLYSYKVYARFDDITAD---DFLHVQTDLDYRRQW 242
            |:...:|.:.|...:.|.:.:|..:. |:||....|..|:..|::|.   |.||   |..||.:|
 Worm    17 VKNLCEDSEGWVEVYKKKDITICTQNIEKSSYQMIKAIAQLPDVSATVVYDVLH---DSAYRAKW 78

  Fly   243 DDTALRLELISE-DPVPGSNSHLIYWEMQWPRLFANRDYVYCRRYIKDDNKKLIFICNRGATHNT 306
            |...::.|.|.. :|    |:.:.|:.:........||:|..|.:::.|..:|  ||:....|..
 Worm    79 DKYMIKQETIGTINP----NNDVCYYSLNSVSPIRPRDFVMQRSWLETDKDRL--ICSHSVCHED 137

  Fly   307 YPALSGKVRVTDYWSLMVIKPFRGFHEPGLHFVLTYFDDPGIPIPQNIKSWVTQKQMPEFLTKMY 371
            ||...|.:|.|...|..:||.    .|.|...:.....||...:|..:.:.||:...|:.:.|::
 Worm   138 YPPAKGCIRATVLISGYLIKE----KEQGCEVIYISHSDPKGKLPTWLVNRVTKVVAPKVIKKLH 198

  Fly   372 VATKNY 377
            .|...|
 Worm   199 KACLGY 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6565NP_001285891.1 START_STARD7-like 170..377 CDD:176920 52/199 (26%)
T28D6.7NP_001366874.1 START_STARD10-like 3..223 CDD:176880 53/201 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5863
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.