DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6565 and Pctp

DIOPT Version :9

Sequence 1:NP_001285891.1 Gene:CG6565 / 34749 FlyBaseID:FBgn0032513 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_032822.2 Gene:Pctp / 18559 MGIID:107375 Length:214 Species:Mus musculus


Alignment Length:190 Identity:58/190 - (30%)
Similarity:94/190 - (49%) Gaps:13/190 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 WEPYFSKNEFSIWRRQER-SSLYSYKVYARFDDITADDFLHVQTDLDYRRQWDDTALRL-ELISE 254
            |:.....:..:|:|..:: |.||.|||:...:..:......|..|||||:|||.....| |..|:
Mouse    30 WQLLVEASGITIYRLLDQPSGLYEYKVFGVLEGCSPALLADVYMDLDYRKQWDQYVKELYEKESD 94

  Fly   255 DPVPGSNSHLIYWEMQWPRLFANRDYVYC--RRYIKDDNKKLIFICNRGATHNTYPALSGKVRVT 317
            :.:      :.|||:::|...:||||||.  ||.:..|.:|:..:..:..:...:|..||.:||.
Mouse    95 EQM------VAYWEVKYPFPLSNRDYVYTRQRRDLDVDGRKIYVVLAQSISAPQFPEKSGVIRVK 153

  Fly   318 DYWSLMVIKPFRGFHEPGLHFVLTYFDDPGIPIPQNIKSWVTQKQMPEFLTKMYVATKNY 377
            .|...:.|:   ...:.|....:.|||:||..||..:.:|..:..:|.||..|..|.:||
Mouse   154 QYKQSLAIE---SDGKKGSRVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMVKACQNY 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6565NP_001285891.1 START_STARD7-like 170..377 CDD:176920 56/188 (30%)
PctpNP_032822.2 START_STARD2-like 8..210 CDD:176919 56/188 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430593at33208
OrthoFinder 1 1.000 - - FOG0004152
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.