DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6565 and C06H2.2

DIOPT Version :9

Sequence 1:NP_001285891.1 Gene:CG6565 / 34749 FlyBaseID:FBgn0032513 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_505830.3 Gene:C06H2.2 / 179542 WormBaseID:WBGene00007386 Length:356 Species:Caenorhabditis elegans


Alignment Length:280 Identity:77/280 - (27%)
Similarity:126/280 - (45%) Gaps:32/280 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 ALPNN--QLCDRCQAKKMKYCYC-QLGNQRCKKGQSQPSTSKEAETDPDTSIS--------NCLR 168
            ||..|  |...|.:.|.:.|.|. ..|::|..|.....||:  ..|..|..||        ||..
 Worm    15 ALYRNFRQNWSRFKTKAVLYSYSFYRGDRRFGKFALAASTA--GFTFRDHGISDDRIAECENCEE 77

  Fly   169 PLDLDVRNAPAGTVRIQAQDDQKWEPYFSKNEFSIWRRQERS--SLYSYKVYARFDDITADDFLH 231
              :...|..|.          :.||..:.:.:...:||:...  .:|.||....:.||:...||.
 Worm    78 --EFAHRKTPG----------KGWELLYEEKDMLAFRRRIDGPYEMYEYKCVGTYYDISPRTFLD 130

  Fly   232 VQTDLDYRRQWDDTALRLELISEDPVPGSNSHLIYWEMQWPRLFANRDYVYCRRYIKDDNKKLIF 296
            .|.||.||::|||..:.:|::.|:    :.:.||.|..::|.....|:|||.||....:::|...
 Worm   131 AQNDLKYRKEWDDNIVTIEVVKEE----NENELIRWVSKFPYPMYPREYVYVRRTWVSEDEKYAV 191

  Fly   297 ICNRGATHNTYPALS-GKVRVTDYWSLMVIKPFRGFHEPGLHFVLTYFDDPGIPIPQNIKSWVTQ 360
            :.:.......:|::| ..|||..|.|.|.|:....:...|:.::|||.|:|...||:.:.:|:..
 Worm   192 LDSESVQPEVFPSISESNVRVRSYTSRMSIRAHSNWESHGVDYILTYCDNPEANIPRYVYNWMVN 256

  Fly   361 KQMPEFLTKMYVATKNYACS 380
            |..|.||.:::.|.:....|
 Worm   257 KGGPYFLRQVHKAAREIESS 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6565NP_001285891.1 START_STARD7-like 170..377 CDD:176920 57/209 (27%)
C06H2.2NP_505830.3 SRPBCC 71..272 CDD:387369 59/216 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162618
Domainoid 1 1.000 98 1.000 Domainoid score I4503
eggNOG 1 0.900 - - E1_KOG2761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430593at33208
OrthoFinder 1 1.000 - - FOG0004152
OrthoInspector 1 1.000 - - oto18974
orthoMCL 1 0.900 - - OOG6_107016
Panther 1 1.100 - - LDO PTHR19308
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7794
SonicParanoid 1 1.000 - - X5180
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.