DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6565 and stard7

DIOPT Version :9

Sequence 1:NP_001285891.1 Gene:CG6565 / 34749 FlyBaseID:FBgn0032513 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_001121480.1 Gene:stard7 / 100158578 XenbaseID:XB-GENE-981983 Length:330 Species:Xenopus tropicalis


Alignment Length:247 Identity:83/247 - (33%)
Similarity:132/247 - (53%) Gaps:14/247 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 LRPLDLDVRNAPAGTVRIQAQ-----DDQKWEPYFSKNEFSIWRRQ-ERSSLYSYKVYARFDDIT 225
            :||.: |::....|..|.|.|     :||.||......||.:|||. |.:.||.|:|:..:.|:|
 Frog    75 VRPAE-DMKRMRLGVERFQGQTSTYNEDQGWELVIDNKEFKLWRRPIEGTHLYQYRVFGCYRDVT 138

  Fly   226 ADDFLHVQTDLDYRRQWDDTALRLELISEDPVPGSNSHLIYWEMQWPRLFANRDYVYCRRYIKDD 290
            ...|.:||.|.:||::||...::|::|..|.:.|  |.:|:|...:|....:|||||.|:|..|.
 Frog   139 PRQFFNVQLDTEYRKKWDALVIKLDIIERDALSG--SEIIHWVTHFPYPMYSRDYVYVRKYHIDQ 201

  Fly   291 NKKLIFICNRGATHNTYPALSGKVRVTDYWSLMVIKPFRGFHEPGLHFVLTYFDDPGIPIPQNIK 355
            ...::.:.:|...|.:.|.....|||.:|.|.|||:|...|.|.|..::|||.|:|....|:...
 Frog   202 ENNIMVLVSRAVEHPSVPESPDYVRVRNYQSQMVIQPHTTFDENGFDYLLTYSDNPQTVFPRYCV 266

  Fly   356 SWVTQKQMPEFLTKMYVATKNYACSRAIKMKDMFHGFALINDEYTANEQRGS 407
            :|:....||:||.|:::||.. |.::.||::|    :.....:...:|.|.|
 Frog   267 NWMVSSGMPDFLEKLHMATVQ-AKNKEIKVRD----YISFRSQDCGSESRAS 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6565NP_001285891.1 START_STARD7-like 170..377 CDD:176920 74/212 (35%)
stard7NP_001121480.1 START_STARD7-like 100..288 CDD:176920 69/190 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 126 1.000 Domainoid score I5375
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H32463
Inparanoid 1 1.050 149 1.000 Inparanoid score I4283
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D430593at33208
OrthoFinder 1 1.000 - - FOG0004152
OrthoInspector 1 1.000 - - oto104155
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R7794
SonicParanoid 1 1.000 - - X5180
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.