DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6565 and stard14

DIOPT Version :9

Sequence 1:NP_001285891.1 Gene:CG6565 / 34749 FlyBaseID:FBgn0032513 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_956514.1 Gene:stard14 / 100001416 ZFINID:ZDB-GENE-040426-963 Length:271 Species:Danio rerio


Alignment Length:222 Identity:51/222 - (22%)
Similarity:81/222 - (36%) Gaps:35/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 QAQDDQKWEPYFSKNEFSIWRRQ-----------ERSSLYSYKVYARFDDITADDFLHVQTDLDY 238
            |....:.|...:.||:..:|..|           ..|.::..:......|::|.....|..|..|
Zfish    20 QCLSTENWVNKYDKNDMEVWVEQAPLSASINNKGNYSKVHKIRCQINIKDVSAATMYDVLHDGQY 84

  Fly   239 RRQWDDTAL------RLELISEDPVPGSNSHLIYWEMQWPRLFANRDYVYCRRYIKDDNKKLIFI 297
            |:.||.|.|      ||         ..|:.:.|:....|:...|||.|..|.:...:|:.:|. 
Zfish    85 RKTWDPTMLESFDIARL---------AHNADVGYYSWICPKPLKNRDVVTLRSWQASENEYVII- 139

  Fly   298 CNRGATHNTYPALSGKVRVTDYWSLMVIKPFRGFHEPGLHFVLTYFD--DPGIPIPQNIKSWVTQ 360
             |....|..||.....||.....:..:|||     ......:.||..  ||...:|:.:.:..:|
Zfish   140 -NFSVKHPKYPPRKDLVRAVSLMTGYLIKP-----TGPQSCIFTYLSQADPKGSLPKWVVNKASQ 198

  Fly   361 KQMPEFLTKMYVATKNYACSRAIKMKD 387
            ...|:.|...:.|.:||...:|....|
Zfish   199 VLAPKVLRSAHKAGQNYPAWKAANSPD 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6565NP_001285891.1 START_STARD7-like 170..377 CDD:176920 47/210 (22%)
stard14NP_956514.1 START_STARD10-like 3..234 CDD:176880 51/222 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2761
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.