DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Bdp1 and Bdp1

DIOPT Version :9

Sequence 1:NP_609643.2 Gene:Bdp1 / 34748 FlyBaseID:FBgn0032512 Length:695 Species:Drosophila melanogaster
Sequence 2:NP_001186124.1 Gene:Bdp1 / 294687 RGDID:1308512 Length:310 Species:Rattus norvegicus


Alignment Length:294 Identity:67/294 - (22%)
Similarity:111/294 - (37%) Gaps:64/294 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PMSPSKAQARQRVRPTPV--------------FGQRRNSFVGSPMASDYEGDYQSPATPTRRERY 152
            |..|:...|.:...||.|              .|...|...|.  .|:.|.....|:..::|.:.
  Rat    36 PPEPATGSAPKPAEPTDVPAVDSGGAEPQEQAPGSSNNEKTGD--GSNVEESSTLPSAASQRRKR 98

  Fly   153 LSGSSS-----------GTPLQQQVH-SPMP-PSPYKYLPPASPGMGRIRTESTCSTYSEGGSKQ 204
            :||:||           ..||....| :|.| |:|.|...|.|......:.........|...|:
  Rat    99 VSGTSSLGQPPVSAPSQSRPLSTVNHDAPQPNPTPAKEKQPCSDRYRIYKARKLREMLKEELRKE 163

  Fly   205 RKGDDRSQSQIGQRLNARRDFETRFNKGVPDKSTFKMMDMIFYNPENNPMVPKQSVTTIKDESGG 269
            :|             ..:..|.|..::..||:|...|.|.|:|.|::|||     .::::.|...
  Rat   164 KK-------------QWKNKFATNESQRPPDRSKMTMRDFIYYLPDSNPM-----TSSVEQEKKC 210

  Fly   270 DDSKPAVSQLLEPKGEST---------------SAMLVPQLKLDANGEMIIDEKTLEIETTAEVE 319
            :.|. |.:...|.:.:||               ..:|||::|:..:|.:|:||::|.:|......
  Rat   211 EKSL-APTPTREQENQSTQDANDNEDVEEEVDDGPLLVPRVKVAEDGSIILDEESLTVEVLRTKG 274

  Fly   320 ARKVLANSSLILMDETTGDNGFYKRHKRTPYWTS 353
            ...|..|..:.....||..:.|.|.:...| |::
  Rat   275 PCVVEENDPIFERGSTTTYSSFRKNYYSKP-WSN 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Bdp1NP_609643.2 Myb_DNA-bind_7 345..419 CDD:292585 2/9 (22%)
SANT 350..395 CDD:197842 1/4 (25%)
Bdp1NP_001186124.1 DUF4551 60..>164 CDD:291746 24/116 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166353776
Domainoid 1 1.000 63 1.000 Domainoid score I10047
eggNOG 1 0.900 - - E1_COG5118
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005120
OrthoInspector 1 1.000 - - oto97640
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22929
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.