DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B22 and CIB22

DIOPT Version :9

Sequence 1:NP_001285889.1 Gene:ND-B22 / 34747 FlyBaseID:FBgn0032511 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_567970.1 Gene:CIB22 / 829622 AraportID:AT4G34700 Length:117 Species:Arabidopsis thaliana


Alignment Length:88 Identity:28/88 - (31%)
Similarity:47/88 - (53%) Gaps:1/88 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SHKRQVCSLYKRALRNLESWYDRRNVYRYRAVQLRARFDENRS-KDLGEGIRLLACGQRELFETR 73
            :.|.:|..||:|||::..:|...|:::...|..||.:|:.|:. :|:....:|:|.|:.|..:.|
plant    15 AQKERVRILYRRALKDTLNWAVHRHIFYRDASDLREKFNVNQDVEDVDRIDKLIAHGEAEYNKWR 79

  Fly    74 HFQPRNFANSAGGCAFEREVIPP 96
            |..|.....:.||..|.|...||
plant    80 HPDPYIVPWAPGGSKFCRNPTPP 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B22NP_001285889.1 Complex1_LYR 13..71 CDD:283097 18/58 (31%)
CIB22NP_567970.1 Complex1_LYR_NDUFB9_LYRM3 16..92 CDD:380758 22/75 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3466
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 44 1.000 Inparanoid score I2682
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1553121at2759
OrthoFinder 1 1.000 - - FOG0006392
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104166
Panther 1 1.100 - - LDO PTHR12868
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.870

Return to query results.
Submit another query.