DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B22 and Ndufb9

DIOPT Version :9

Sequence 1:NP_001285889.1 Gene:ND-B22 / 34747 FlyBaseID:FBgn0032511 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_075661.1 Gene:Ndufb9 / 66218 MGIID:1913468 Length:179 Species:Mus musculus


Alignment Length:133 Identity:63/133 - (47%)
Similarity:91/133 - (68%) Gaps:7/133 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PLAIVSHKRQVCSLYKRALRNLESWYDRRNVYRYRAVQLRARFDENRS-KDLGEGIRLLACGQRE 68
            |.|.::|:::|..|||||||:||||...|:.|||.|..:||||:|::: ||:....:||...:.|
Mouse     6 PPAYLTHQQKVLRLYKRALRHLESWCIHRDKYRYFACLMRARFEEHKNEKDMMRATQLLREAEEE 70

  Fly    69 LFETRHFQPRNFANSAGGCAFER----EVIPPDWVLDYWHPLEKAQYPEYFAKREQRKKEFVTWW 129
            .::.:|.||..|.:|.||.:|||    :|  |:|.||||||.|||.||:||:||||.||..:..|
Mouse    71 FWQNQHPQPYIFPDSPGGTSFERYECYKV--PEWCLDYWHPSEKAMYPDYFSKREQWKKLRMESW 133

  Fly   130 EKQ 132
            :::
Mouse   134 DRE 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B22NP_001285889.1 Complex1_LYR 13..71 CDD:283097 27/58 (47%)
Ndufb9NP_075661.1 Complex1_LYR_NDUFB9_LYRM3 12..88 CDD:380758 33/75 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838069
Domainoid 1 1.000 51 1.000 Domainoid score I11519
eggNOG 1 0.900 - - E1_KOG3466
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3669
Inparanoid 1 1.050 124 1.000 Inparanoid score I4695
Isobase 1 0.950 - 0 Normalized mean entropy S4687
OMA 1 1.010 - - QHG46434
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006392
OrthoInspector 1 1.000 - - oto93254
orthoMCL 1 0.900 - - OOG6_104166
Panther 1 1.100 - - LDO PTHR12868
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3685
SonicParanoid 1 1.000 - - X6119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.