DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B22 and NDUFB9

DIOPT Version :9

Sequence 1:NP_001285889.1 Gene:ND-B22 / 34747 FlyBaseID:FBgn0032511 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_004996.1 Gene:NDUFB9 / 4715 HGNCID:7704 Length:179 Species:Homo sapiens


Alignment Length:129 Identity:61/129 - (47%)
Similarity:88/129 - (68%) Gaps:7/129 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 VSHKRQVCSLYKRALRNLESWYDRRNVYRYRAVQLRARFDENRS-KDLGEGIRLLACGQRELFET 72
            ::|:::|..|||||||:||||..:|:.|||.|..:||||:|::: ||:.:..:||...:.|.:..
Human    10 LTHQQKVLRLYKRALRHLESWCVQRDKYRYFACLMRARFEEHKNEKDMAKATQLLKEAEEEFWYR 74

  Fly    73 RHFQPRNFANSAGGCAFER----EVIPPDWVLDYWHPLEKAQYPEYFAKREQRKKEFVTWWEKQ 132
            :|.||..|.:|.||.::||    :|  |:|.||.|||.|||.||:|||||||.||.....||::
Human    75 QHPQPYIFPDSPGGTSYERYDCYKV--PEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWERE 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B22NP_001285889.1 Complex1_LYR 13..71 CDD:283097 27/58 (47%)
NDUFB9NP_004996.1 Complex1_LYR 14..72 CDD:283097 27/57 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..162 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147979
Domainoid 1 1.000 52 1.000 Domainoid score I11514
eggNOG 1 0.900 - - E1_KOG3466
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3669
Inparanoid 1 1.050 116 1.000 Inparanoid score I4825
Isobase 1 0.950 - 0 Normalized mean entropy S4687
OMA 1 1.010 - - QHG46434
OrthoDB 1 1.010 - - D1553121at2759
OrthoFinder 1 1.000 - - FOG0006392
OrthoInspector 1 1.000 - - oto89686
orthoMCL 1 0.900 - - OOG6_104166
Panther 1 1.100 - - LDO PTHR12868
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3685
SonicParanoid 1 1.000 - - X6119
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.