DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B22 and Ndufb9

DIOPT Version :9

Sequence 1:NP_001285889.1 Gene:ND-B22 / 34747 FlyBaseID:FBgn0032511 Length:144 Species:Drosophila melanogaster
Sequence 2:NP_001120766.1 Gene:Ndufb9 / 299954 RGDID:1307114 Length:179 Species:Rattus norvegicus


Alignment Length:133 Identity:62/133 - (46%)
Similarity:92/133 - (69%) Gaps:7/133 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PLAIVSHKRQVCSLYKRALRNLESWYDRRNVYRYRAVQLRARFDENRS-KDLGEGIRLLACGQRE 68
            |.|.::|:::|..|||||||:||||...|:.|||.|..:||||:|::: ||:.:..:||...:.|
  Rat     6 PPAYLTHRQKVLRLYKRALRHLESWCVHRDKYRYLACLMRARFEEHKNEKDMMKATQLLRQAEEE 70

  Fly    69 LFETRHFQPRNFANSAGGCAFER----EVIPPDWVLDYWHPLEKAQYPEYFAKREQRKKEFVTWW 129
            .::.:|.||..|.:|.||.::||    :|  |:|.||||||.|||.||:||:||||.||..:..|
  Rat    71 FWQNQHPQPYIFPDSPGGTSYERYECYKV--PEWCLDYWHPSEKAVYPDYFSKREQWKKLRMESW 133

  Fly   130 EKQ 132
            :::
  Rat   134 DRE 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-B22NP_001285889.1 Complex1_LYR 13..71 CDD:283097 27/58 (47%)
Ndufb9NP_001120766.1 Complex1_LYR 14..73 CDD:283097 27/58 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341847
Domainoid 1 1.000 52 1.000 Domainoid score I11215
eggNOG 1 0.900 - - E1_KOG3466
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3669
Inparanoid 1 1.050 123 1.000 Inparanoid score I4641
OMA 1 1.010 - - QHG46434
OrthoDB 1 1.010 - - D1553121at2759
OrthoFinder 1 1.000 - - FOG0006392
OrthoInspector 1 1.000 - - oto96797
orthoMCL 1 0.900 - - OOG6_104166
Panther 1 1.100 - - LDO PTHR12868
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X6119
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.