DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6523 and AT4G32580

DIOPT Version :9

Sequence 1:NP_609641.1 Gene:CG6523 / 34745 FlyBaseID:FBgn0032509 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_194984.1 Gene:AT4G32580 / 829393 AraportID:AT4G32580 Length:160 Species:Arabidopsis thaliana


Alignment Length:124 Identity:36/124 - (29%)
Similarity:59/124 - (47%) Gaps:4/124 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VVNVSAAEEYQKYINADKTTVALFAAEWAEQCGQVKDALEELAKITGEKLQFISLNAEQFPEISM 67
            |.::.:.||.....::....|..|.|.|.:...|:......|| ....:..|..:.||:.||||.
plant     5 VKDIVSKEELDNLRHSGAPLVLHFWASWCDASKQMDQVFSHLA-TDFPRAHFFRVEAEEHPEISE 68

  Fly    68 KHQIEAVPTVIFFAKGSAVDRVDGVDIAAISAKSKKLAEN---ASSAAATGQTLEERLK 123
            .:.:..||..:||..|..||.::|.|.::::.|..|:|.:   ||...|.|.|:.|.:|
plant    69 AYSVALVPYFVFFKDGKTVDTLEGADPSSLANKVGKVAGSITPASLGLAAGPTILETVK 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6523NP_609641.1 TRX_PICOT 8..102 CDD:239282 26/93 (28%)
GRX_PICOT_like 122..211 CDD:239326 1/2 (50%)
AT4G32580NP_194984.1 TRX_PICOT 10..102 CDD:239282 25/92 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1449534at2759
OrthoFinder 1 1.000 - - FOG0003496
OrthoInspector 1 1.000 - - otm3109
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.