DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6523 and GRXS17

DIOPT Version :9

Sequence 1:NP_609641.1 Gene:CG6523 / 34745 FlyBaseID:FBgn0032509 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_192404.1 Gene:GRXS17 / 825835 AraportID:AT4G04950 Length:488 Species:Arabidopsis thaliana


Alignment Length:247 Identity:80/247 - (32%)
Similarity:125/247 - (50%) Gaps:35/247 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VVNVSAAEEYQKYINADKTTVALFAAEWAEQCGQVKDALEELAKITGEKLQFISLNAEQFPEISM 67
            |.::.:..|......:....|..|.|.|.:...|:......|| ....:..|..:.||:.||||.
plant     5 VKDIVSKAELDNLRQSGAPVVLHFWASWCDASKQMDQVFSHLA-TDFPRAHFFRVEAEEHPEISE 68

  Fly    68 KHQIEAVPTVIFFAKGSAVDRVDGVDIAAISAKSKKLAENASSA--------------------- 111
            .:.:.|||..:||..|..||.::|.|.::::.|..|:|.:::||                     
plant    69 AYSVAAVPYFVFFKDGKTVDTLEGADPSSLANKVGKVAGSSTSAEPAAPASLGLAAGPTILETVK 133

  Fly   112 -------------AATGQTLEERLKALINTAPLMIFMKGDRNGPRCGFSKQLIGIVNETNLPYET 163
                         .:|...|:.||:.|.|:.|:|:||||....||||||::::.|:.|.|:.:.:
plant   134 ENAKASLQDRAQPVSTADALKSRLEKLTNSHPVMLFMKGIPEEPRCGFSRKVVDILKEVNVDFGS 198

  Fly   164 FDILGDEEVRQGLKTYSDWPTYPQVYVKGELIGGLDIIKELLANNELESTLK 215
            ||||.|.|||:|||.:|:|||:||:|..|||:||.||...:..:.||:...|
plant   199 FDILSDNEVREGLKKFSNWPTFPQLYCNGELLGGADIAIAMHESGELKDAFK 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6523NP_609641.1 TRX_PICOT 8..102 CDD:239282 26/93 (28%)
GRX_PICOT_like 122..211 CDD:239326 44/88 (50%)
GRXS17NP_192404.1 PTZ00062 7..251 CDD:240250 79/245 (32%)
TRX_PICOT 10..102 CDD:239282 25/92 (27%)
GRX_PICOT_like 157..246 CDD:239326 44/88 (50%)
GRX_PICOT_like 287..376 CDD:239326
GRX_PICOT_like 394..483 CDD:239326
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 84 1.000 Domainoid score I2846
eggNOG 1 0.900 - - E1_COG0278
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1786
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1449534at2759
OrthoFinder 1 1.000 - - FOG0003496
OrthoInspector 1 1.000 - - otm3109
orthoMCL 1 0.900 - - OOG6_101660
Panther 1 1.100 - - LDO PTHR10293
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2861
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.