DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6523 and CXIP1

DIOPT Version :9

Sequence 1:NP_609641.1 Gene:CG6523 / 34745 FlyBaseID:FBgn0032509 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_191050.1 Gene:CXIP1 / 824655 AraportID:AT3G54900 Length:173 Species:Arabidopsis thaliana


Alignment Length:116 Identity:49/116 - (42%)
Similarity:75/116 - (64%) Gaps:1/116 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KSKKLAENASSAAATGQTLEERLKALINTAPLMIFMKGDRNGPRCGFSKQLIGIVNETNLPYETF 164
            |.|......|::|.|.| |::.|:.|:|:..:::||||.|:.|.||||..::.|:...|:|:|..
plant    54 KLKPTKFRCSASALTPQ-LKDTLEKLVNSEKVVLFMKGTRDFPMCGFSNTVVQILKNLNVPFEDV 117

  Fly   165 DILGDEEVRQGLKTYSDWPTYPQVYVKGELIGGLDIIKELLANNELESTLK 215
            :||.:|.:|||||.||:|||:||:|:.||..||.||..|.....||:..::
plant   118 NILENEMLRQGLKEYSNWPTFPQLYIGGEFFGGCDITLEAFKTGELQEEVE 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6523NP_609641.1 TRX_PICOT 8..102 CDD:239282 1/1 (100%)
GRX_PICOT_like 122..211 CDD:239326 41/88 (47%)
CXIP1NP_191050.1 GRX_PICOT_like 75..164 CDD:239326 41/88 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1449534at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.