DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6523 and CXIP2

DIOPT Version :9

Sequence 1:NP_609641.1 Gene:CG6523 / 34745 FlyBaseID:FBgn0032509 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_565885.1 Gene:CXIP2 / 818407 AraportID:AT2G38270 Length:293 Species:Arabidopsis thaliana


Alignment Length:202 Identity:59/202 - (29%)
Similarity:100/202 - (49%) Gaps:43/202 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 EKLQFISLNAEQFPEISMKHQIEAVPTVIFFAKGSAVDRVDGVDIAAISAKSKKL---------- 104
            ::|||:.::......:|.  .:::||.:....|...|:..|    .|:..::.||          
plant    97 DELQFVGISRNIAASVSA--HLKSVPELCGSVKVGIVEEPD----KAVLTQAWKLWIEEHIKVTG 155

  Fly   105 ----AENASSAAATGQT--------------------LEERLKALINTAPLMIFMKGDRNGPRCG 145
                ...:.:.....||                    |||.:..|:..:.::.|:||.|:.|:||
plant   156 KVPPGNKSGNNTFVKQTPRKKSDIRLTPGRHVELTVPLEELIDRLVKESKVVAFIKGSRSAPQCG 220

  Fly   146 FSKQLIGIVNETNLPYETFDILGDE---EVRQGLKTYSDWPTYPQVYVKGELIGGLDIIKELLAN 207
            ||::::||:....:.|||.|:|.||   .:|:.||.||:|||:||::|||||:||.||:..:..|
plant   221 FSQRVVGILESQGVDYETVDVLDDEYNHGLRETLKNYSNWPTFPQIFVKGELVGGCDILTSMYEN 285

  Fly   208 NELESTL 214
            .||.:.|
plant   286 GELANIL 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6523NP_609641.1 TRX_PICOT 8..102 CDD:239282 10/51 (20%)
GRX_PICOT_like 122..211 CDD:239326 40/91 (44%)
CXIP2NP_565885.1 GIY-YIG_AtGrxS16 88..161 CDD:198404 12/69 (17%)
GRX_PICOT_like 197..289 CDD:239326 40/91 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1449534at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.