DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6523 and Glrx5

DIOPT Version :9

Sequence 1:NP_609641.1 Gene:CG6523 / 34745 FlyBaseID:FBgn0032509 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_082695.1 Gene:Glrx5 / 73046 MGIID:1920296 Length:152 Species:Mus musculus


Alignment Length:107 Identity:43/107 - (40%)
Similarity:69/107 - (64%) Gaps:3/107 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 SAAATGQTLEERLKALINTAPLMIFMKGDRNGPRCGFSKQLIGIVNETNL-PYETFDILGDEEVR 173
            :|::.||.  |:|.||:....:::|:||....|:||||..::.|:....: .|..:::|.|.|:|
Mouse    31 AASSGGQA--EQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELR 93

  Fly   174 QGLKTYSDWPTYPQVYVKGELIGGLDIIKELLANNELESTLK 215
            ||:|.||:|||.||||:.||.:||.||:.::..|.:|...||
Mouse    94 QGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELK 135

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG6523NP_609641.1 TRX_PICOT 8..102 CDD:239282
GRX_PICOT_like 122..211 CDD:239326 36/89 (40%)
Glrx5NP_082695.1 GRX_PICOT_like 41..131 CDD:239326 36/89 (40%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:Q86SX6 93..97 3/3 (100%)