DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6523 and GLRX5

DIOPT Version :9

Sequence 1:NP_609641.1 Gene:CG6523 / 34745 FlyBaseID:FBgn0032509 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_057501.2 Gene:GLRX5 / 51218 HGNCID:20134 Length:157 Species:Homo sapiens


Alignment Length:109 Identity:43/109 - (39%)
Similarity:68/109 - (62%) Gaps:1/109 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 ASSAAATGQTLEERLKALINTAPLMIFMKGDRNGPRCGFSKQLIGIVNETNL-PYETFDILGDEE 171
            |:.:.|.|....|:|.||:....:::|:||....|:||||..::.|:....: .|..:::|.|.|
Human    31 AAGSGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPE 95

  Fly   172 VRQGLKTYSDWPTYPQVYVKGELIGGLDIIKELLANNELESTLK 215
            :|||:|.||:|||.||||:.||.:||.||:.::..|.:|...||
Human    96 LRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELK 139

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG6523NP_609641.1 TRX_PICOT 8..102 CDD:239282
GRX_PICOT_like 122..211 CDD:239326 36/89 (40%)
GLRX5NP_057501.2 GRX_PICOT_like 45..135 CDD:239326 36/89 (40%)
Glutathione binding. /evidence=ECO:0000269|PubMed:21029046 97..101 3/3 (100%)