DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6523 and glrx5

DIOPT Version :9

Sequence 1:NP_609641.1 Gene:CG6523 / 34745 FlyBaseID:FBgn0032509 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_001004919.1 Gene:glrx5 / 448300 XenbaseID:XB-GENE-972922 Length:154 Species:Xenopus tropicalis


Alignment Length:122 Identity:40/122 - (32%)
Similarity:74/122 - (60%) Gaps:7/122 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 SAKSKKLAENASS----AAATGQTLEERLKALINTAPLMIFMKGDRNGPRCGFSKQLIGIVNETN 158
            ||:::::..:.|:    ::.:|:  .|.:..|:....:::|:||....|.||||..::.|:....
 Frog    16 SARTQQVCVSLSARRWLSSDSGK--PEHVDGLVKKDKVVVFIKGTPAQPMCGFSNAVVQILRMHG 78

  Fly   159 L-PYETFDILGDEEVRQGLKTYSDWPTYPQVYVKGELIGGLDIIKELLANNELESTL 214
            : .|..:::|.|:::|||:|.||:|||.||||..||.:||.||:.::..|.:|...|
 Frog    79 VQDYAAYNVLEDQDLRQGIKNYSNWPTIPQVYFNGEFVGGCDILLQMHQNGDLVEEL 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6523NP_609641.1 TRX_PICOT 8..102 CDD:239282 2/3 (67%)
GRX_PICOT_like 122..211 CDD:239326 33/89 (37%)
glrx5NP_001004919.1 GRX_PICOT_like 42..132 CDD:239326 33/89 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1449534at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.