DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6523 and Glrx5

DIOPT Version :9

Sequence 1:NP_609641.1 Gene:CG6523 / 34745 FlyBaseID:FBgn0032509 Length:216 Species:Drosophila melanogaster
Sequence 2:XP_006240544.1 Gene:Glrx5 / 362776 RGDID:1308383 Length:233 Species:Rattus norvegicus


Alignment Length:126 Identity:43/126 - (34%)
Similarity:69/126 - (54%) Gaps:22/126 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 SAAATGQTLEERLKALINTAPLMIFMKGDRNGPRCGFSKQLIGIVNETNL-PYETFDILGDEEVR 173
            :|::.||.  |:|.||:....:::|:||....|:||||..::.|:....: .|..:::|.|.|:|
  Rat    93 AASSGGQA--EQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLEDPELR 155

  Fly   174 QG-------------------LKTYSDWPTYPQVYVKGELIGGLDIIKELLANNELESTLK 215
            ||                   :|.||:|||.||||:.||.:||.||:.::..|.:|...||
  Rat   156 QGQARGTWRRGRGELEQISRSIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6523NP_609641.1 TRX_PICOT 8..102 CDD:239282
GRX_PICOT_like 122..211 CDD:239326 36/108 (33%)
Glrx5XP_006240544.1 GRX_PICOT_like 103..212 CDD:239326 36/108 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1449534at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.