DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6523 and CG14407

DIOPT Version :9

Sequence 1:NP_609641.1 Gene:CG6523 / 34745 FlyBaseID:FBgn0032509 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_572974.1 Gene:CG14407 / 32410 FlyBaseID:FBgn0030584 Length:159 Species:Drosophila melanogaster


Alignment Length:123 Identity:46/123 - (37%)
Similarity:76/123 - (61%) Gaps:1/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 IAAISAKSKKLAENASSAAATGQTLEE-RLKALINTAPLMIFMKGDRNGPRCGFSKQLIGIVNET 157
            |.|.:|....|....::.||||..::: .:..|:.|..:::||||:...||||||..::.|:...
  Fly    15 ILATTAPQSLLTRFLAADAATGAAVDKATMDKLVRTNKVVVFMKGNPQAPRCGFSNAVVQIMRMH 79

  Fly   158 NLPYETFDILGDEEVRQGLKTYSDWPTYPQVYVKGELIGGLDIIKELLANNELESTLK 215
            .:.|:..|:|.:|.:|||:|.|:||||.|||::.||.:||.||:.::..:.:|...||
  Fly    80 GVQYDAHDVLQNESLRQGVKDYTDWPTIPQVFINGEFVGGCDILLQMHQSGDLIEELK 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6523NP_609641.1 TRX_PICOT 8..102 CDD:239282 3/7 (43%)
GRX_PICOT_like 122..211 CDD:239326 35/88 (40%)
CG14407NP_572974.1 GRX_PICOT_like 44..132 CDD:239326 35/87 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456376
Domainoid 1 1.000 65 1.000 Domainoid score I555
eggNOG 1 0.900 - - E1_COG0278
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D108345at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm51366
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.