DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6523 and Glrx3

DIOPT Version :9

Sequence 1:NP_609641.1 Gene:CG6523 / 34745 FlyBaseID:FBgn0032509 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_075629.2 Gene:Glrx3 / 30926 MGIID:1353653 Length:337 Species:Mus musculus


Alignment Length:220 Identity:106/220 - (48%)
Similarity:145/220 - (65%) Gaps:15/220 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VVNVSAAEEYQKYINADKT---TVALFAAEWAEQCGQVKDALEELAKITGEKLQFISLNAEQFPE 64
            ||.|.:|:::::.:.. ||   .|..|.|.||.||.|:.|.:.|||| ....:.|:.|.||..||
Mouse    15 VVEVGSAQQFEELLRL-KTKSLLVVHFWAPWAPQCVQMNDVMAELAK-EHPHVSFVKLEAEAVPE 77

  Fly    65 ISMKHQIEAVPTVIFFAKGSAVDRVDGVDIAAISAKSKKLAENASSAA---ATGQTLEE----RL 122
            :|.|::|.:|||.:||.....|||:||.....:   :||:..:.||.|   :|.:.|:|    ||
Mouse    78 VSEKYEISSVPTFLFFKNSQKVDRLDGAHAPEL---TKKVQRHVSSGAFPPSTNEHLKEDLSLRL 139

  Fly   123 KALINTAPLMIFMKGDRNGPRCGFSKQLIGIVNETNLPYETFDILGDEEVRQGLKTYSDWPTYPQ 187
            |.|.:.||.|:||||....||||||||::.|:::.|:.:.:|||..||||||||||||:||||||
Mouse   140 KKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQ 204

  Fly   188 VYVKGELIGGLDIIKELLANNELES 212
            :||.|||||||||||||.|:.||::
Mouse   205 LYVSGELIGGLDIIKELEASEELDT 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6523NP_609641.1 TRX_PICOT 8..102 CDD:239282 35/96 (36%)
GRX_PICOT_like 122..211 CDD:239326 58/88 (66%)
Glrx3NP_075629.2 TRX_PICOT 20..115 CDD:239282 37/99 (37%)
GRX_PICOT_like 139..227 CDD:239326 57/87 (66%)
GRX_PICOT_like 241..329 CDD:239326
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849376
Domainoid 1 1.000 100 1.000 Domainoid score I7019
eggNOG 1 0.900 - - E1_COG0278
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 194 1.000 Inparanoid score I3832
Isobase 1 0.950 - 0 Normalized mean entropy S1091
OMA 1 1.010 - - QHG53575
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003496
OrthoInspector 1 1.000 - - oto92534
orthoMCL 1 0.900 - - OOG6_101660
Panther 1 1.100 - - LDO PTHR10293
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R497
SonicParanoid 1 1.000 - - X2861
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.740

Return to query results.
Submit another query.