DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Grx3 and grx5

DIOPT Version :10

Sequence 1:NP_609641.1 Gene:Grx3 / 34745 FlyBaseID:FBgn0032509 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_593888.1 Gene:grx5 / 2543483 PomBaseID:SPAPB2B4.02 Length:146 Species:Schizosaccharomyces pombe


Alignment Length:105 Identity:42/105 - (40%)
Similarity:67/105 - (63%) Gaps:7/105 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 TGQTLEERLKALINTAPLMIFMKGDRNGPRCGFSKQLIGIVNETNLPYE---TFDILGDEEVRQG 175
            |.|.||:.:|    ..|:::||||....|.||||.:.|.|::..|:..:   |:::|.::|:|:|
pombe    25 TRQALEQAVK----EDPIVLFMKGTPTRPMCGFSLKAIQILSLENVASDKLVTYNVLSNDELREG 85

  Fly   176 LKTYSDWPTYPQVYVKGELIGGLDIIKELLANNELESTLK 215
            :|.:|||||.||:|:.||.:||.||:..:..:.||...||
pombe    86 IKEFSDWPTIPQLYINGEFVGGSDILASMHKSGELHKILK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Grx3NP_609641.1 TRX_PICOT 8..102 CDD:239282
GRX_PICOT_like 122..211 CDD:239326 35/91 (38%)
grx5NP_593888.1 GRX_PICOT_like 29..120 CDD:239326 36/94 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.