DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6523 and grx5

DIOPT Version :9

Sequence 1:NP_609641.1 Gene:CG6523 / 34745 FlyBaseID:FBgn0032509 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_593888.1 Gene:grx5 / 2543483 PomBaseID:SPAPB2B4.02 Length:146 Species:Schizosaccharomyces pombe


Alignment Length:105 Identity:42/105 - (40%)
Similarity:67/105 - (63%) Gaps:7/105 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 TGQTLEERLKALINTAPLMIFMKGDRNGPRCGFSKQLIGIVNETNLPYE---TFDILGDEEVRQG 175
            |.|.||:.:|    ..|:::||||....|.||||.:.|.|::..|:..:   |:::|.::|:|:|
pombe    25 TRQALEQAVK----EDPIVLFMKGTPTRPMCGFSLKAIQILSLENVASDKLVTYNVLSNDELREG 85

  Fly   176 LKTYSDWPTYPQVYVKGELIGGLDIIKELLANNELESTLK 215
            :|.:|||||.||:|:.||.:||.||:..:..:.||...||
pombe    86 IKEFSDWPTIPQLYINGEFVGGSDILASMHKSGELHKILK 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6523NP_609641.1 TRX_PICOT 8..102 CDD:239282
GRX_PICOT_like 122..211 CDD:239326 35/91 (38%)
grx5NP_593888.1 GrxD 22..128 CDD:223355 42/105 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.