DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6523 and F47B8.3

DIOPT Version :9

Sequence 1:NP_609641.1 Gene:CG6523 / 34745 FlyBaseID:FBgn0032509 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_506549.1 Gene:F47B8.3 / 185896 WormBaseID:WBGene00009804 Length:284 Species:Caenorhabditis elegans


Alignment Length:169 Identity:39/169 - (23%)
Similarity:65/169 - (38%) Gaps:39/169 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 TGEKLQFISLNAEQFPEISMKHQIEAVPTVIFFAKGSAVDRVDGVDIAAISAKSKKLAENASSAA 112
            |.|.|:..:.|.|:.| :|.|                |.:..|.:.......:.:....|.:|..
 Worm   143 TFETLEEDTANPEKLP-VSRK----------------ATNFPDQLTKQTAQREEESEIRNDNSKM 190

  Fly   113 ATGQTLEERLKALINTAPLMIFMK--GDRNGPRCGFSKQLIGIVNETNLPYETFDILGDEEVRQG 175
            ..||....:    |...|:::|:.  .|..      :...|..:::..:.|..||:..|.|:|..
 Worm   191 ENGQAKIYK----IFRKPVLLFVNYLEDEQ------TLSTIQSLSDNQIDYTIFDVSTDSEIRFI 245

  Fly   176 LKTYSDWPTYPQVYVKGELIGGLDIIKELLANNELESTL 214
            .|..||..|:||::|.|..        |.|:|  ||:.|
 Worm   246 SKALSDCETFPQLFVDGAF--------EPLSN--LENLL 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6523NP_609641.1 TRX_PICOT 8..102 CDD:239282 10/53 (19%)
GRX_PICOT_like 122..211 CDD:239326 22/90 (24%)
F47B8.3NP_506549.1 DUF713 <43..143 CDD:368344 39/169 (23%)
Thioredoxin_like <221..264 CDD:381987 15/42 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10293
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.