DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6523 and glrx-5

DIOPT Version :9

Sequence 1:NP_609641.1 Gene:CG6523 / 34745 FlyBaseID:FBgn0032509 Length:216 Species:Drosophila melanogaster
Sequence 2:NP_499610.1 Gene:glrx-5 / 176662 WormBaseID:WBGene00013029 Length:142 Species:Caenorhabditis elegans


Alignment Length:121 Identity:42/121 - (34%)
Similarity:77/121 - (63%) Gaps:4/121 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 KSKKLAENASSAAATG--QTLEERLKALINTAPLMIFMKGDRNGPRCGFSKQLIGIVNETNLPYE 162
            ::...:.:||||...|  ..:.:|:..::....:::||||.:..|.||||:.:..:::..|:.::
 Worm    14 RAANFSASASSAGGGGLSDEVRKRIDGIVKKDDVVVFMKGTQQEPACGFSRNVKLVLDFHNVKFQ 78

  Fly   163 TFDILGDEEVRQGLKTYSDWPTYPQVYVKGELIGGLDIIKELLANNELESTL--KG 216
            .:::|.|:|:|:|:|.:|:|||.||||||||.:||.||:..:..:.|:...|  ||
 Worm    79 DYNVLTDQELREGVKIFSEWPTIPQVYVKGEFVGGCDILISMHKDGEISDFLDEKG 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6523NP_609641.1 TRX_PICOT 8..102 CDD:239282 0/1 (0%)
GRX_PICOT_like 122..211 CDD:239326 33/88 (38%)
glrx-5NP_499610.1 GRX_PICOT_like 38..126 CDD:239326 32/87 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0278
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1449534at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.