DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG18754

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_652652.3 Gene:CG18754 / 59145 FlyBaseID:FBgn0042106 Length:341 Species:Drosophila melanogaster


Alignment Length:328 Identity:85/328 - (25%)
Similarity:127/328 - (38%) Gaps:58/328 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 EKHCVPYEQCNEGLMVDGKFYPDRSRTTLDENCHYMEKCC-NIPDKLPTPKIPEEMMSCPCGGRH 91
            ||....:.||  ||..:|           .|..|.:..|| .:.|.||..:        .||...
  Fly    58 EKDVFAHRQC--GLDPNG-----------HELLHMVYVCCPELGDVLPNKQ--------TCGQTT 101

  Fly    92 DLWYYLRPLGYKQQEAKFGEFPWLVAVYGSDTYLCSGALITPLAVITTAHCV------QNS-EME 149
            .::   |..|  .:.|:..|:||:|.:      |....|.....|:|.||||      ||. .::
  Fly   102 PVF---RDRG--AENAELNEYPWMVLL------LYENRLSLIRYVLTAAHCVIGGYLTQNDLVLK 155

  Fly   150 KVRLLAGEWDAAVELEPQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICL 214
            .|||.....|........||....|.:|.||..:|.....:...|.|:..:.|.:....:|||||
  Fly   156 SVRLGESTTDCITSESRCPHLDVEVGQTTVHQGFTSSGGTYRNDIALLRLQFPVRYTKKIQPICL 220

  Fly   215 PPPRIMYNYSQCYVSGWQRSDFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHA-HNDSLLCA 278
            .............:|||..:...:..|..   |:....|..|        |.|..: .:.|.:||
  Fly   221 LDAEFPLQDLNLQISGWDPTKSSQTLITS---TVKERNPADC--------LNRYPSFRSASQVCA 274

  Fly   279 GGD-KGDFVCGDVDMTAVPLMCPL-SGHDDRFHLAGLLTRTAR-CDGPQLLGIYTNVKLYRQWID 340
            ||. |||...|   ::..|:|..: ||.|:...|||:.:...: |....:.|:||.:..:.:||.
  Fly   275 GGQRKGDTCAG---ISGSPVMGIMGSGVDEFVFLAGIASYGQQYCYSAGIPGVYTKIGHFSEWIK 336

  Fly   341 LKL 343
            ..|
  Fly   337 ANL 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 65/245 (27%)
Tryp_SPc 105..339 CDD:214473 64/244 (26%)
CG18754NP_652652.3 CLIP 35..84 CDD:288855 9/38 (24%)
Tryp_SPc 108..338 CDD:238113 67/251 (27%)
Tryp_SPc 108..335 CDD:214473 65/248 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.