DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG34409

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001097728.2 Gene:CG34409 / 5740854 FlyBaseID:FBgn0085438 Length:511 Species:Drosophila melanogaster


Alignment Length:276 Identity:74/276 - (26%)
Similarity:114/276 - (41%) Gaps:57/276 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RPLGYKQQEAKFGEFPWLVAVYGSD------TYLCSGALITPLAVITTAHCVQN--SEMEKVRLL 154
            |.||..|..|  |:||||..:...:      ::.|||:||:...::|.||||.|  |::|...:.
  Fly   249 RLLGGDQASA--GQFPWLTRIAYRNRSSSRISFRCSGSLISSNHIVTAAHCVVNLVSDLELSHVR 311

  Fly   155 AGEWDAAVELEPQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLP--PP 217
            .|..|.|...        ::.:.:|||||.|...|::||:|.::...     ....|||||  .|
  Fly   312 LGSQDGATPF--------AIEQVIVHPNYDQPKYANDIALLRINSTN-----GTFTPICLPFNGP 363

  Fly   218 RIMYN--YSQCYV-SGWQ-RSDFGRAAILPKRWTL---YVLPPDQCRTKLRLSLLGRRHAHNDSL 275
            ..:.|  ..|..| :||. .|....:::.|...|.   ::..|....|...::...........:
  Fly   364 ITLGNRLIGQIGVAAGWSIGSTENNSSMDPSNSTAGVRFIRLPIVNTTSCAIAYASLSENFQQPI 428

  Fly   276 ------LCAGGDKGDFVC-GDVDMTAVPLM----CPLSGHDDRFHLAGLLTRTARCDGPQLL--- 326
                  |||.|...:.|| ||   :..|.|    ..:.|...|:.:.|::     ..||.|.   
  Fly   429 VITPNHLCAQGMPMNDVCRGD---SGGPFMDDGTSGVFGTSGRYTIIGIV-----AFGPTLCGVT 485

  Fly   327 ---GIYTNVKLYRQWI 339
               |:||.|..:..||
  Fly   486 TIPGVYTLVSSFSDWI 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 70/269 (26%)
Tryp_SPc 105..339 CDD:214473 68/267 (25%)
CG34409NP_001097728.2 CLIP 26..71 CDD:288855
Tryp_SPc 249..501 CDD:214473 72/274 (26%)
Tryp_SPc 252..501 CDD:238113 70/271 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435460
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.