DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG34171

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001097175.2 Gene:CG34171 / 5740474 FlyBaseID:FBgn0085200 Length:292 Species:Drosophila melanogaster


Alignment Length:239 Identity:58/239 - (24%)
Similarity:96/239 - (40%) Gaps:52/239 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 DTYLCSGALITPLAVITTAHCVQNSE---MEKVRLLAGEWDAAVELEPQPHQQRSVVE---TLVH 180
            |.:.|:|.::|...|:|:|||:.:..   |...|::..   ....|...|..:..||:   .::|
  Fly    53 DNHFCTGVILTNRHVLTSAHCITDKNGVMMSPKRIVVA---LCASLFKTPESEEFVVDIHNMIIH 114

  Fly   181 PNYTQMPLAHN-IAILLVD---KEKPFQLAPNVQPICLPPPRIMYNYS-----QCY----VSGWQ 232
            |.|.:.  .|| |||:.:.   |.....|||.|          :.|.|     .|.    :.|.:
  Fly   115 PYYHRN--QHNDIAIIKLKRYVKLDGHHLAPVV----------LGNSSLEVGNDCKTIGGIFGVR 167

  Fly   233 RSDFG--RAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVCGDVDMTAV 295
            |..||  .:.:|.   .:.:.|.|:| .|::.||:..| ..|:.|:|....:......|.   ..
  Fly   168 RQRFGSFHSMLLV---NVELRPFDEC-LKVKKSLMAAR-PENEDLICVKSTEKQMCTTDF---GG 224

  Fly   296 PLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQWI 339
            ||.|  .|     .|.|:...:..|..|..: .:::|..|..|:
  Fly   225 PLFC--DG-----QLYGIALGSINCSSPDPV-FFSDVSFYNSWV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 58/239 (24%)
Tryp_SPc 105..339 CDD:214473 57/237 (24%)
CG34171NP_001097175.2 Trypsin 29..260 CDD:278516 57/237 (24%)
Tryp_SPc 38..263 CDD:304450 58/239 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435379
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.