DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and si:dkeyp-93a5.3

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_021326347.1 Gene:si:dkeyp-93a5.3 / 571565 ZFINID:ZDB-GENE-131127-100 Length:328 Species:Danio rerio


Alignment Length:297 Identity:76/297 - (25%)
Similarity:118/297 - (39%) Gaps:71/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 CNIPDKLPTPKIPEEMMSCPCGGRHDLWYYLRPLGYKQQEAKFGEFPWLVAVYGSDTYLCSGALI 131
            |..|:....|:|        .||               ..|..|.:||:|::.|...:.|.|:||
Zfish    25 CGRPNPTLNPRI--------VGG---------------VNATHGAWPWMVSLQGRYGHFCGGSLI 66

  Fly   132 TPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRSVVETLVHPNYTQMPLAHNIAILL 196
            ....|:|.|||:.:.....:.:..|:|.:.|  .......|::...:.||:|:.:...::||:| 
Zfish    67 NNQWVLTAAHCIVDQTPSSIIVYLGKWRSYV--ADVNSISRTIRHIIPHPSYSNITKDNDIALL- 128

  Fly   197 VDKEKPFQLAPNVQ------PICLPP-----PRIMYNYSQCYVSGWQRSDFGRAAI--LPKRWTL 248
                   ||...||      ||||..     ||    .:..:|:||  .|.|....  :..|.|:
Zfish   129 -------QLTSTVQYTDYIKPICLADENSNFPR----GTNSWVAGW--GDIGVLGTGGIRGRTTV 180

  Fly   249 YV-LPPDQCRTKLRLSLLGRRHAHN-------DSLLCAG---GDKGDFVCGDVDMTAVPLMCPLS 302
            .| ||......:..|.:......:|       .:::|||   |.|..| .||   :..|||...|
Zfish   181 SVPLPHPGILQEAELKVYSNADCNNICHGRITPNMICAGTRPGGKATF-SGD---SGGPLMTKCS 241

  Fly   303 GHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQWI 339
                .:..||:|:....|..|.|..::..|..|:|||
Zfish   242 ----VWVQAGVLSHGYGCAQPNLPEVFIRVSEYKQWI 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 70/259 (27%)
Tryp_SPc 105..339 CDD:214473 68/257 (26%)
si:dkeyp-93a5.3XP_021326347.1 Tryp_SPc 36..274 CDD:238113 71/284 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D382647at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.