DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and Jon99Fi

DIOPT Version :10

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_651800.2 Gene:Jon99Fi / 43622 FlyBaseID:FBgn0039778 Length:267 Species:Drosophila melanogaster


Alignment Length:204 Identity:42/204 - (20%)
Similarity:64/204 - (31%) Gaps:77/204 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   322 LPATFWEKSIL----EK--PDDGRDLVCHASAWEFSKTDDVRIKQCTR-------VTMEQF---- 369
            :|..||::..|    :|  |...:.|:...|:...:.|.|   ..|:.       .|:..|    
  Fly    17 IPKIFWQEQELLLPAQKRFPKSRKTLLWGRSSVSATTTTD---NPCSTHNRNIWCATLGYFDHTN 78

  Fly   370 -FTVHHELGHVQYFLQYQHLPSMYRDGANPGF------------HEAVGDVLSLSVSTPKHLEKI 421
             .|....||      .|.||....   |:.|:            |....:...|.||..|.|.: 
  Fly    79 TLTNDSTLG------LYAHLSGRI---ASHGYPLSQERFALATVHRGTAEASRLRVSVLKRLTR- 133

  Fly   422 GLLKDYVEDEESKLNQFYGSALNKLVFLPFAYTLDKYRWGIFRGDIKPEQYNCKFWEMRSKFSGV 486
             ||:..|.          ||        |.....|:|...:.         :|. |     .:..
  Fly   134 -LLRPLVP----------GS--------PLGSADDRYGVAVL---------SCG-W-----LAAS 164

  Fly   487 EPPVVRSES 495
            :||::||.|
  Fly   165 DPPLIRSVS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 PRK06406 <19..>80 CDD:235796
Tryp_SPc 105..339 CDD:214473 6/22 (27%)
Jon99FiNP_651800.2 Tryp_SPc 38..262 CDD:238113 36/183 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.