DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and Jon99Ci

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_524555.1 Gene:Jon99Ci / 43545 FlyBaseID:FBgn0003358 Length:272 Species:Drosophila melanogaster


Alignment Length:261 Identity:58/261 - (22%)
Similarity:98/261 - (37%) Gaps:71/261 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 AKFGEFPWLVAV---YGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQP 168
            |..|:.|::|.|   ...:.:.|.|::|....|:|.|||.           ||..:|::......
  Fly    47 ASEGQVPYIVGVSLNSNGNWWWCGGSIIGHTWVLTAAHCT-----------AGADEASLYYGAVN 100

  Fly   169 HQQRSVVETLVHPNYTQMP----LAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYN-YSQCYV 228
            :.:.:...|:...|:.:.|    |.|::|::.......:.|   |..|.||.....|| |...:|
  Fly   101 YNEPAFRHTVSSENFIRYPHYVGLDHDLALIKTPHVDFYSL---VNKIELPSLDDRYNSYENNWV 162

  Fly   229 --SGWQRSDFGRAAILPKRWT-LYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVC-GD 289
              :||.....|...:...|.. |.|:...:|:     :..|...| :::.:|.....|...| ||
  Fly   163 QAAGWGAIYDGSNVVEDLRVVDLKVISVAECQ-----AYYGTDTA-SENTICVETPDGKATCQGD 221

  Fly   290 VDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGI----------------YTNVKLYRQW 338
                        ||       ..|:|:    :|.:|:||                :|.|..|.:|
  Fly   222 ------------SG-------GPLVTK----EGDKLIGITSFVSAYGCQVGGPAGFTRVTKYLEW 263

  Fly   339 I 339
            |
  Fly   264 I 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 58/261 (22%)
Tryp_SPc 105..339 CDD:214473 56/259 (22%)
Jon99CiNP_524555.1 Tryp_SPc 40..264 CDD:214473 56/259 (22%)
Tryp_SPc 41..266 CDD:238113 58/261 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435363
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.