DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG4815

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_651607.1 Gene:CG4815 / 43360 FlyBaseID:FBgn0039568 Length:265 Species:Drosophila melanogaster


Alignment Length:239 Identity:47/239 - (19%)
Similarity:93/239 - (38%) Gaps:48/239 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 VAVYGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRSVVETLVH 180
            :.::.....:||..|:||..::|.|||.:|....|..::.|: .|..........:..::...:|
  Fly    51 IQLFNGRKLVCSATLLTPRHILTAAHCFENLNRSKFHVIGGK-SAEFTWHGNNFNKNKLIRVQIH 114

  Fly   181 PNYTQMPLAHNIAILLVD---KEKPFQLAPNVQPICLPPPRIMYNYSQCYVSGWQRSDFGRAAIL 242
            |.|.:|....::|:....   :.|....|...:.:..|..:::       .:||   .|....  
  Fly   115 PKYAKMKFIADVAVAKTKYPLRSKYIGYAQLCRSVLHPRDKLI-------AAGW---GFEGGV-- 167

  Fly   243 PKRWTLYVLPPDQCRTK----LRLSLLGRRHAHND-------SLLCAGGDKGDFVC-GDVDMTAV 295
               |       |:.|.|    :::.::.:|.....       :::|||......:| ||   :..
  Fly   168 ---W-------DESRKKTFRSMKVGIVSKRDCEKQLDRKMPPNIICAGAYNNKTLCFGD---SGG 219

  Fly   296 PLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQWI 339
            ||   |.|.    .:.|:.|.|.:|...:...:|..|:.|.::|
  Fly   220 PL---LLGR----QVCGINTWTFKCGNNEKPDVYMGVRYYAKFI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 47/239 (20%)
Tryp_SPc 105..339 CDD:214473 46/237 (19%)
CG4815NP_651607.1 Tryp_SPc 49..259 CDD:304450 47/239 (20%)
Trypsin 49..256 CDD:278516 46/237 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435378
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.