DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG31199

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_732546.1 Gene:CG31199 / 42456 FlyBaseID:FBgn0051199 Length:293 Species:Drosophila melanogaster


Alignment Length:343 Identity:76/343 - (22%)
Similarity:129/343 - (37%) Gaps:101/343 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LMVDGKFYPD-RSRTTLDENCHYMEKCCNIPDKLPTPKIPEEMMSCPCGGRHDLWYYLRPLGYKQ 104
            |::.|.|.|: ||....|:.|...::              ::|::                    
  Fly     9 LLLVGLFGPEVRSAKVNDDQCGAFDE--------------DQMLN-------------------- 39

  Fly   105 QEAKFG---EFPWLV-AVYGS-------DTYLCSGALITPLAVITTAHC-VQN---SEMEKVRLL 154
            .::.|.   |..|:. .|||.       |.. |.|.|::...|:..||| ||.   :|...|.|.
  Fly    40 MQSTFAIPTEHQWVARIVYGKGFEGKIRDNG-CLGVLVSKRTVLAPAHCFVQYNGVAEAFSVHLG 103

  Fly   155 AGEWDAAVELE--------PQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQP 211
            .....|.|.:.        .:|.|:..:.|..:||:|....|.:::|:|.:.::.  ::.|||.|
  Fly   104 VHNKSAPVGVRVCETDGYCVRPSQEIKLAEIAIHPDYDSRTLKNSLAVLTLQRDA--KIYPNVMP 166

  Fly   212 ICLPPPRIMYN--YSQCYVSGWQR--SDFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHAHN 272
            ||:|||.::..  .:|.:|....|  .||..     |.| :..|....|::|::..:        
  Fly   167 ICMPPPSLLNETLVAQTFVVAGLRVFEDFRL-----KTW-VNTLSRGFCQSKVKTLV-------- 217

  Fly   273 DSLLCAGGDKGDFVCG-DVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYR 336
                    ...:.||| .....|..|..||.|...:.|:.         ....|:||..:.:   
  Fly   218 --------TSSNTVCGYHKQPVAYYLGAPLVGLQKKGHVT---------QNYYLVGIMIDWR--- 262

  Fly   337 QWIDLKLRERNLDIRHYM 354
             |.:.::....|.||:||
  Fly   263 -WENNRIMSSFLAIRNYM 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 62/262 (24%)
Tryp_SPc 105..339 CDD:214473 61/261 (23%)
CG31199NP_732546.1 Tryp_SPc 45..257 CDD:304450 58/245 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.