DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG5255

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:275 Identity:70/275 - (25%)
Similarity:112/275 - (40%) Gaps:63/275 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 QEAKFGEFPWLVAV--YGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQ 167
            :||..|..|:.:::  .||..:.|.||:|....:||.|||.:..:....|:|.|..|.       
  Fly    34 EEAAAGLAPYQISLQGIGSGAHSCGGAIIDERWIITAAHCTRGRQATAFRVLTGTQDL------- 91

  Fly   168 PHQQRS-------VVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYSQ 225
             ||..|       :||   |.||......::||:|.:::...|..|  .||:.|....::.. |:
  Fly    92 -HQNGSKYYYPDRIVE---HSNYAPRKYRNDIALLHLNESIVFDNA--TQPVELDHEALVPG-SR 149

  Fly   226 CYVSGWQRSDFGRAAILPKR-WTLYV--LPPDQCRTKLRLSLLGRRHAHNDSL------LCAGGD 281
            ..::||.....|  ..:|.| .:|.|  :|.:|||.           ||::|.      :|...|
  Fly   150 LLLTGWGTLSLG--GDVPARLQSLEVNYVPFEQCRA-----------AHDNSTRVDIGHVCTFND 201

  Fly   282 KGDFVC-GDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARC-----DGPQLLGIYTNVKLYRQWID 340
            ||...| ||   :..||:     |:.:  |..|:.....|     |....:..|.:  ..|..:.
  Fly   202 KGRGACHGD---SGGPLV-----HNGK--LVALVNWGLPCAKGYPDAHASISYYHD--FIRTHLS 254

  Fly   341 LKLRERNLDIRHYMV 355
            |...:.:.||...|:
  Fly   255 LSKTDSSEDIEEEMI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 66/258 (26%)
Tryp_SPc 105..339 CDD:214473 66/257 (26%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 65/253 (26%)
Tryp_SPc 30..252 CDD:238113 66/256 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435555
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.