DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG5246

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:270 Identity:60/270 - (22%)
Similarity:118/270 - (43%) Gaps:52/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 RHDLWYYLRPLGYKQQEAKF--------GEFPWLVAVYGS-DTYLCSGALITPLAVITTAHCVQN 145
            ||.|.::   ||:.:.|.:.        |..|:.|::..: ..::|.|::|.|..::|.|||:: 
  Fly    26 RHQLNHH---LGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGEHVCGGSIIAPQWILTAAHCME- 86

  Fly   146 SEMEKVRLLAGEWDAAVELEPQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQ 210
            ..::.::::.|..|..     :|..:..|..:.:|.::.: |..|| .|.|:...||.......|
  Fly    87 WPIQYLKIVTGTVDYT-----RPGAEYLVDGSKIHCSHDK-PAYHN-DIALIHTAKPIVYDDLTQ 144

  Fly   211 PICLPP----PRIMYNYSQCYVSGW-QRSDFGRAAILPKRWTLYVLPPDQCRTKLR-LSLLGRRH 269
            ||.|..    |::   ..:..::|| ....:||.:...::..|..:..|.|::::| .:.|...|
  Fly   145 PIKLASKGSLPKV---GDKLTLTGWGSTKTWGRYSTQLQKIDLNYIDHDNCQSRVRNANWLSEGH 206

  Fly   270 AHNDSLLCAGGDKGDFVC-GDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLG---IYT 330
                  :|....:|:..| ||   :..||:      |....|.|::.....|    .:|   ::.
  Fly   207 ------VCTFTQEGEGSCHGD---SGGPLV------DANQTLVGVVNWGEAC----AIGYPDVFG 252

  Fly   331 NVKLYRQWID 340
            :|..|..||:
  Fly   253 SVAYYHDWIE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 54/253 (21%)
Tryp_SPc 105..339 CDD:214473 53/252 (21%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 52/249 (21%)
Tryp_SPc 42..263 CDD:238113 54/251 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435554
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.