DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG17475

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001287372.1 Gene:CG17475 / 42069 FlyBaseID:FBgn0038481 Length:288 Species:Drosophila melanogaster


Alignment Length:258 Identity:62/258 - (24%)
Similarity:99/258 - (38%) Gaps:67/258 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 QEAKFGEFPW---LVAVYGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEP 166
            ::.:.||..:   |..:||.  ::|.|.:|....|:|.||||.......:|::.|    .||.| 
  Fly    54 EDVQLGEAKYQISLQGMYGG--HICGGCIIDERHVLTAAHCVYGYNPTYLRVITG----TVEYE- 111

  Fly   167 QPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYSQCYVSGW 231
            :|.....|.|..:|.||......::||::.::....|.  ...||..||...:. |.:|..::||
  Fly   112 KPDAVYFVEEHWIHCNYNSPDYHNDIALIRLNDTIKFN--EYTQPAELPTAPVA-NGTQLLLTGW 173

  Fly   232 QRSDF--GRAAILPKRWTLYVL---------------PPDQCRTKLRLSLLGRRHAHNDSLLCAG 279
            ..::.  ....||.|.:..:|:               |...|    .|:..|:...|.||    |
  Fly   174 GSTELWGDTPDILQKAYLTHVVYSTCQEIMNNDPSNGPCHIC----TLTTGGQGACHGDS----G 230

  Fly   280 GDKGDFVCGDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGI---YTNVKLYRQWI 339
            |                   ||: |:      |:|........|..||:   :.||..|.:||
  Fly   231 G-------------------PLT-HN------GVLYGLVNWGYPCALGVPDSHANVYYYLEWI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 62/258 (24%)
Tryp_SPc 105..339 CDD:214473 60/256 (23%)
CG17475NP_001287372.1 Tryp_SPc 49..267 CDD:214473 60/256 (23%)
Tryp_SPc 50..269 CDD:238113 62/258 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435556
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.