DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG14088

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_649100.2 Gene:CG14088 / 40098 FlyBaseID:FBgn0036858 Length:289 Species:Drosophila melanogaster


Alignment Length:290 Identity:62/290 - (21%)
Similarity:98/290 - (33%) Gaps:93/290 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 CGGRHDLWYYLRP--LGYKQQEAKFGEFPWLVAVYGSDTYLCSGALITPLAVITTAHCVQNSEME 149
            ||.|.|   .|.|  :|           ||...::.....:..|.||....::|..||..:..:.
  Fly    31 CGERRD---GLSPDIVG-----------PWTAILHHFGRIVGVGTLIHERFILTDVHCGDSIGVI 81

  Fly   150 KVRLLAGEWDAAVELEPQPHQQRSVVETLVHPNYTQMPLAHNIAIL-----LVDKEKPFQLAPNV 209
            :.||  ||:.   .:..:..:...|.....:.|:.....|:|:.::     :|.||       ::
  Fly    82 RARL--GEYG---RIGSELAEDHIVAAFFSNANFNPETQANNMGLMKLLRTVVYKE-------HI 134

  Fly   210 QPICLPPPRIMYNYSQ--CYVSG--WQRSDFGRAAILPKRWTLYVLPPDQCRTKLRLSLLGRRHA 270
            .|:|:.....|..::.  .|.:|  |:.||..              |..:.:|.:|:        
  Fly   135 IPVCILMDSRMQTFADELDYFNGTTWKNSDKS--------------PMLRSKTVIRM-------- 177

  Fly   271 HNDSLLCAGGDKGDFVCG--DVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQ---LLGI-- 328
               ...|...|.|.|..|  |:|....|     ||        ..|||.....||.   |.||  
  Fly   178 ---PQACGKLDHGQFCAGHKDLDSCDEP-----SG--------AALTREIDYIGPNRTVLFGIAN 226

  Fly   329 -----------YTNVKLYRQWIDLKLRERN 347
                       ||:|....|||.:.:...|
  Fly   227 SVEVKCSNSRTYTDVVQLHQWISMVIYSSN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 53/261 (20%)
Tryp_SPc 105..339 CDD:214473 52/260 (20%)
CG14088NP_649100.2 Tryp_SPc 42..251 CDD:304450 55/269 (20%)
Tryp_SPc 42..248 CDD:214473 53/266 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.