DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG18223

DIOPT Version :10

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_649077.1 Gene:CG18223 / 40068 FlyBaseID:FBgn0036832 Length:322 Species:Drosophila melanogaster


Alignment Length:248 Identity:58/248 - (23%)
Similarity:97/248 - (39%) Gaps:70/248 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 DTYLCSGALITPLAVITTAHCVQNSE--MEKVRLLAGEWDAAVELEPQPHQQRSV-VETLVHPNY 183
            |.:.|.|.:|:...::|:|||..:..  :.:.|:|.........|:.:.....:: |:.:..|:.
  Fly    75 DNHFCGGVIISRTYILTSAHCAMDKRKIVHRSRVLVVVAGTTNRLKSRKGLSLNMEVKKIFVPDK 139

  Fly   184 TQMPLAHNIAILLVDKEKPFQLAPNVQPICLP--PPRIMYNYSQCYVSGWQR--------SDFGR 238
            ..:...:|||::::.|:.|.. .|.|..|.||  .|....||:   |.||.|        ||.  
  Fly   140 FTVFNTNNIALMMLAKKLPLD-NPLVGVINLPTADPEPGLNYT---VLGWGRIFKGGPLASDI-- 198

  Fly   239 AAILPKRWTLYV----LPPDQCRTKLRLSLLGRRHAHNDSLLCAG------------GDKGDFVC 287
                     |::    ||.|.|..|:        |...:.::|||            ||.|.   
  Fly   199 ---------LHIDVELLPRDICEKKV--------HIFKEEMMCAGNLNNTMDENPCAGDTGS--- 243

  Fly   288 GDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQWID 340
                        ||..::..|   |:::....|....|..|||||.::..||:
  Fly   244 ------------PLIFNETVF---GVVSYRVGCGSKTLPSIYTNVYMHMDWIN 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 PRK06406 <19..>80 CDD:235796
Tryp_SPc 105..339 CDD:214473 56/245 (23%)
CG18223NP_649077.1 Tryp_SPc 60..280 CDD:214473 56/245 (23%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.