DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG11529

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_648558.1 Gene:CG11529 / 39395 FlyBaseID:FBgn0036264 Length:287 Species:Drosophila melanogaster


Alignment Length:277 Identity:64/277 - (23%)
Similarity:104/277 - (37%) Gaps:80/277 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 YKQQEAKFG---EFPWLVAVYGSDTY----LCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWD 159
            |...::|:|   :||:.|.:.|...:    ||.|.|:....::|..||........|.|      
  Fly    28 YAVGQSKYGRIEKFPYQVMLIGKQLWRKRILCGGTLLDKRWILTAGHCTMGVTHYDVYL------ 86

  Fly   160 AAVELEPQPHQQRSVVET-------------LVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQP 211
                      ..:||.:|             :||..:.....|::||::.:.::..|  .|.:||
  Fly    87 ----------GTKSVEDTEVSGGLVLRSNKFIVHERFNPETAANDIALVKLPQDVAF--TPRIQP 139

  Fly   212 ICLPPPRIMYNYSQ-----CYVSGW------QRSDFGRAAILPKRWT-LYVLPPDQCRTKLRLSL 264
            ..||.   .|.:.|     ...|||      ..||       ..::| |.|:...:|..:..:..
  Fly   140 ASLPS---RYRHDQFAGMSVVASGWGAMVEMTNSD-------SMQYTELKVISNAECAQEYDVVT 194

  Fly   265 LGRRHAHNDSLLCAGGDKGDFVC-GDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDG--PQLL 326
            .|        ::||.|.|.:.|| ||   :..||:.     .|...:.| :|.....||  ..:.
  Fly   195 SG--------VICAKGLKDETVCTGD---SGGPLVL-----KDTQIVVG-ITSFGPADGCETNIP 242

  Fly   327 GIYTNVKLYRQWIDLKL 343
            |.:|.|..|..||:.|:
  Fly   243 GGFTRVTHYLDWIESKI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 61/269 (23%)
Tryp_SPc 105..339 CDD:214473 60/268 (22%)
CG11529NP_648558.1 Tryp_SPc 37..258 CDD:238113 60/265 (23%)
Tryp_SPc 37..255 CDD:214473 58/262 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.