DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG3088

DIOPT Version :10

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_648334.1 Gene:CG3088 / 39115 FlyBaseID:FBgn0036015 Length:252 Species:Drosophila melanogaster


Alignment Length:203 Identity:45/203 - (22%)
Similarity:74/203 - (36%) Gaps:42/203 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   110 GEFPWLVAV-YGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRS 173
            |:.|::|.: :|.....|||.:|....::|:|.|:..|....:...|.....|        |...
  Fly    38 GQAPYVVGMAFGQSNIWCSGTIIGDTWILTSAQCLTGSSGVTIYFGATRLSQA--------QFTV 94

  Fly   174 VVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYSQCY------VSGWQ 232
            .|.|..:....|     ::|::.|.:   ...:..|..:.||..|   |.||.|      |.||.
  Fly    95 TVGTSEYVTGNQ-----HLALVRVPR---VGFSNRVNRVALPSLR---NRSQRYENWWANVCGWG 148

  Fly   233 RSDFGRAAILPKRWT-LYVLPPDQCRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVC-GDV----- 290
            .:.|........:.. |.::..::|     ::..|.... :|.:||.....|...| ||.     
  Fly   149 VTTFSNGLTDALQCVDLQIMSNNEC-----IAFYGSTTV-SDQILCTRTPSGRSTCFGDAGSPLI 207

  Fly   291 ---DMTAV 295
               |.|.|
  Fly   208 TKQDSTVV 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 PRK06406 <19..>80 CDD:235796
Tryp_SPc 105..339 CDD:214473 45/203 (22%)
CG3088NP_648334.1 Tryp_SPc 29..244 CDD:214473 45/203 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.