DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and CG10469

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_648025.1 Gene:CG10469 / 38696 FlyBaseID:FBgn0035678 Length:267 Species:Drosophila melanogaster


Alignment Length:259 Identity:62/259 - (23%)
Similarity:105/259 - (40%) Gaps:55/259 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 AKFGEFPWLVAVY----GS--DTYLCSGALITPLAVITTAHCVQN--SEMEKVRLLAGEWDAAVE 163
            ||..:.|:.|.:.    ||  :..:|.|.:::...:||.|||:|:  |.:.||.:..|       
  Fly    30 AKAKQLPYQVGLLCYFEGSKDEPNMCGGTILSNRWIITAAHCLQDPKSNLWKVLIHVG------- 87

  Fly   164 LEPQPHQQRSVV----ETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYS 224
             :.:....:.:|    .|:||..:.:..:.::||::.:.|:..|.  ..:||..||..:..|...
  Fly    88 -KVKSFDDKEIVVNRSYTIVHKKFDRKTVTNDIALIKLPKKLTFN--KYIQPAKLPSAKKTYTGR 149

  Fly   225 QCYVSGWQRSDFGRAAILPKRWTLYVLPP----DQCRTKLRLSLLG--RRHAHN-----DS---L 275
            :..:|||..:    ...||.:...|:..|    .:|..:....|.|  ::..||     ||   |
  Fly   150 KAIISGWGLT----TKQLPSQVLQYIRAPIISNKECERQWNKQLGGKSKKVVHNGFICIDSKKGL 210

  Fly   276 LCAGGDKGDFVCGDVDMTAVPLMCPLSGHDDRFHLAGLLTRTARCDGPQLLGIYTNVKLYRQWI 339
            .|.|...|..|..|...|.|.::.  .|.|....|             :|..:.|.|..|.:||
  Fly   211 PCRGDSGGPMVLDDGSRTLVGIVS--HGFDGECKL-------------KLPDVSTRVSSYLKWI 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 62/259 (24%)
Tryp_SPc 105..339 CDD:214473 60/257 (23%)
CG10469NP_648025.1 Tryp_SPc 23..259 CDD:214473 60/257 (23%)
Tryp_SPc 24..260 CDD:238113 62/259 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435373
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.