DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and Jon65Aii

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_648014.1 Gene:Jon65Aii / 38684 FlyBaseID:FBgn0035666 Length:259 Species:Drosophila melanogaster


Alignment Length:144 Identity:34/144 - (23%)
Similarity:54/144 - (37%) Gaps:36/144 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 GYKQQEAKFGEFPWLVAV-----YGSDTYLCSGALITPLAVITTAHCVQNSEMEKVRLLAGEWDA 160
            ||...|   |:.|::||:     .|...| |.|::|....|:|.|||...:....:     .:.|
  Fly    40 GYPAYE---GKVPYIVALRFDNGNGGGWY-CGGSIIGHEWVLTAAHCTYGASYVTI-----SYGA 95

  Fly   161 AVELEPQPHQQRSVVETLVHPNYTQMPLAHNIAILLVDKEKPFQLAPNVQPICLPPPRIMYNYSQ 225
            ....:||            ..:|....|.::||::.......:.|...|:     .||....|:.
  Fly    96 VWRQQPQ------------FTHYDTGNLHNDIALIRTPHVDFWSLVNKVE-----LPRYDDRYNN 143

  Fly   226 CY-----VSGWQRS 234
            .|     :|||..|
  Fly   144 FYGWWALLSGWGSS 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 32/140 (23%)
Tryp_SPc 105..339 CDD:214473 32/140 (23%)
Jon65AiiNP_648014.1 Tryp_SPc 36..251 CDD:214473 34/144 (24%)
Tryp_SPc 37..254 CDD:238113 34/144 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435348
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.