DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9377 and yip7

DIOPT Version :9

Sequence 1:NP_609640.1 Gene:CG9377 / 34743 FlyBaseID:FBgn0032507 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_523944.1 Gene:yip7 / 38680 FlyBaseID:FBgn0040060 Length:270 Species:Drosophila melanogaster


Alignment Length:290 Identity:62/290 - (21%)
Similarity:106/290 - (36%) Gaps:75/290 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 DKLPTPKIPEEMMSCPCGGRHDLWYYLRPLGYKQQEAKFGEFPWLVAVYGSD---TYLCSGALIT 132
            |::.||.|...:.:                   .::|..|:||:.|.:..|.   ::.|.|::|.
  Fly    29 DRVSTPSITGRITN-------------------GKDAVAGQFPYQVGLSFSSSAGSWWCGGSIIG 74

  Fly   133 PLAVITTAHCVQNSEMEKVRLLAGEWDAAVELEPQPHQQRSVVETLVHPNYTQMPLAHNIAILLV 197
            ...|:|.|||...:  ..|.:..|   |.|...|:..|..|..:...|.:|..:.:.::|:::  
  Fly    75 NEWVLTAAHCTDGA--ASVTIYYG---ATVRTSPEFTQVVSSSKFRQHESYLALTIRNDISLI-- 132

  Fly   198 DKEKPFQLAPNVQPICLPPPRIMYNYS-----QCYVSGW-QRSDFGRAAILPKRWT-LYVLPPDQ 255
             :......:..|..|.|  |.:..:||     ....||| ..||...|.....::. |.::...:
  Fly   133 -QTSSVSFSATVNKISL--PAVSNSYSTYEGKTAVASGWGLTSDQATAVSRDLQYVDLTIISNSK 194

  Fly   256 CRTKLRLSLLGRRHAHNDSLLCAGGDKGDFVCGDVDMTAVPLMC------PLSGHDDRFHLAGLL 314
            |:......::..|      :||            ||.|.....|      ||:       |.|:|
  Fly   195 CQETFGSLIVTSR------VLC------------VDTTNKASTCQGDSGGPLA-------LDGVL 234

  Fly   315 ---TRTARCDGPQ--LLGIYTNVKLYRQWI 339
               |.....||.:  ....:|.:..||.||
  Fly   235 IGATSFGSADGCESGAPAAFTRITYYRDWI 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9377NP_609640.1 Tryp_SPc 105..340 CDD:238113 58/256 (23%)
Tryp_SPc 105..339 CDD:214473 56/254 (22%)
yip7NP_523944.1 Tryp_SPc 39..264 CDD:214473 56/278 (20%)
Tryp_SPc 40..267 CDD:238113 58/279 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435364
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.